Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	TIM13.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61570 76 / 1e-19 TIM13 translocase of the inner mitochondrial membrane 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G149800 [exp] 106 / 9e-32 AT1G61570 77 / 3e-20 translocase of the inner mitochondrial membrane 13 (.1) Potri.011G125951 [exp] 44 / 3e-06 AT3G42170 313 / 2e-95 BED zinc finger ;hAT family dimerisation domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010147 [exp] 98 / 6e-27 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1) Lus10017352 [exp] 91 / 2e-25 AT1G61570 92 / 6e-26 translocase of the inner mitochondrial membrane 13 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [poplar] [flax] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Potri.001G452100.1 pacid=42788661 polypeptide=Potri.001G452100.1.p locus=Potri.001G452100 ID=Potri.001G452100.1.v4.1 annot-version=v4.1 ATGGATTCATTTTCTTCACATTCAAGTATGGGATCTGGGTCACCCCAAATGTCAGCAGAAGATTTTAAGGACCAGTTAAAGAATCAACTTGCACAAGCTT ATGCCCAGGAGTTCCTTGAGACTGTGAGGGACAAATGCTTTGCCAAGTGTATAACAAAACCAGGGTCAAGCCTGAGTGGGAGCGAAAGTAGCTGCATCTC CAGGTGTGTGGAACGCTACATTGAGGCTACTGGCATCATCAGTAAAGCTCTTTTCAATGCACCACGCTGA
AA sequence Show only first row Show all	>Potri.001G452100.1 pacid=42788661 polypeptide=Potri.001G452100.1.p locus=Potri.001G452100 ID=Potri.001G452100.1.v4.1 annot-version=v4.1 MDSFSSHSSMGSGSPQMSAEDFKDQLKNQLAQAYAQEFLETVRDKCFAKCITKPGSSLSGSESSCISRCVERYIEATGIISKALFNAPR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61570		TIM13	translocase of the inner mitoc...		Potri.001G452100 [exp]	0	1	TIM13.1
AT1G61570		TIM13	translocase of the inner mitoc...		Potri.011G149800 [exp]	1.00	0.9070	TIM13.2
AT5G21060			Glyceraldehyde-3-phosphate deh...		Potri.004G196200 [exp]	6.08	0.8381
AT3G56070		ROC2	rotamase cyclophilin 2 (.1.2)		Potri.019G014396 [exp]	6.70	0.8865
AT1G14980		CPN10	chaperonin 10 (.1)		Potri.001G274300 [exp]	9.16	0.8995	CPN10.3
AT2G37600			Ribosomal protein L36e family ...		Potri.004G057000 [exp]	10.29	0.9000	RPL36.1
AT4G37660			Ribosomal protein L12/ ATP-dep...		Potri.004G224300 [exp]	11.31	0.8195
AT5G52650			RNA binding Plectin/S10 domain...		Potri.013G027900 [exp]	14.14	0.8934
AT5G50810		TIM8	translocase inner membrane sub...		Potri.015G102000 [exp]	15.81	0.8791
AT1G07070			Ribosomal protein L35Ae family...		Potri.010G194200 [exp]	18.76	0.8683
AT2G46290			Transducin/WD40 repeat-like su...		Potri.010G100101 [exp]	20.49	0.8948

Compare expression of checked genes

Potri.001G452100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.