Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09810 176 / 6e-55 ACT2/7, ACT7 actin 7 (.1) AT3G12110 169 / 2e-52 ACT11 actin-11 (.1) AT3G46520 167 / 8e-52 ACT12 actin-12 (.1) AT5G59370 166 / 3e-51 ACT4 actin 4 (.1.2) AT3G53750 166 / 4e-51 ACT3 actin 3 (.1) AT2G37620 166 / 4e-51 AAC1, ACT1 ARABIDOPSIS ACTIN 1, actin 1 (.1.2) AT3G18780 162 / 6e-50 FIZ2, LSR2, ENL2, DER1, ACT2 LIGHT STRESS-REGULATED 2, FRIZZY AND KINKED SHOOTS 2, ENHANCER OF LRX1 2, DEFORMED ROOT HAIRS 1, actin 2 (.1.2) AT1G49240 162 / 7e-50 FIZ1, ACT8 FRIZZY AND KINKED SHOOTS, actin 8 (.1) AT2G42170 150 / 2e-45 Actin family protein (.1) AT2G42100 150 / 3e-45 Actin-like ATPase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G148000 [exp] 179 / 3e-56 AT5G09810 731 / 0.0 actin 7 (.1) Potri.001G453600 [exp] 178 / 6e-56 AT5G09810 769 / 0.0 actin 7 (.1) Potri.001G309500 [exp] 171 / 3e-53 AT5G09810 775 / 0.0 actin 7 (.1) Potri.019G010400 [exp] 171 / 3e-53 AT5G09810 774 / 0.0 actin 7 (.1) Potri.016G045500 [exp] 170 / 8e-53 AT3G12110 767 / 0.0 actin-11 (.1) Potri.006G192700 [exp] 170 / 8e-53 AT3G12110 767 / 0.0 actin-11 (.1) Potri.010G204300 [exp] 168 / 6e-52 AT3G12110 733 / 0.0 actin-11 (.1) Potri.008G055500 [exp] 168 / 6e-52 AT3G12110 765 / 0.0 actin-11 (.1) Potri.006G139900 [exp] 134 / 2e-38 AT5G09810 554 / 0.0 actin 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005819 [exp] 171 / 4e-53 AT5G09810 778 / 0.0 actin 7 (.1) Lus10005820 [exp] 171 / 4e-53 AT5G09810 778 / 0.0 actin 7 (.1) Lus10006783 [exp] 171 / 4e-53 AT5G09810 778 / 0.0 actin 7 (.1) Lus10001693 [exp] 169 / 9e-53 AT3G12110 673 / 0.0 actin-11 (.1) Lus10016259 [exp] 169 / 2e-52 AT3G46520 767 / 0.0 actin-12 (.1) Lus10004169 [exp] 169 / 3e-52 AT3G12110 723 / 0.0 actin-11 (.1) Lus10016558 [exp] 169 / 3e-52 AT3G12110 768 / 0.0 actin-11 (.1) Lus10040826 [exp] 169 / 3e-52 AT3G12110 768 / 0.0 actin-11 (.1) Lus10005457 [exp] 169 / 3e-52 AT3G12110 768 / 0.0 actin-11 (.1) Lus10029286 [exp] 169 / 3e-52 AT3G46520 768 / 0.0 actin-12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0108 [poplar] [flax] Actin_ATPase PF00022 [poplar] [flax] Actin Actin
Representative CDS sequence Show only first row Show all	>Potri.001G453700.2 pacid=42791085 polypeptide=Potri.001G453700.2.p locus=Potri.001G453700 ID=Potri.001G453700.2.v4.1 annot-version=v4.1 ATGACAGAAATTATGTTTGAAATGTTCGGTGTTCCTGACATGTACGTTGCTATTGGAGCAGAGCTATCCCTTTATGCTAGTGGACGTACTACAGAGATTA GGCACTCATTCACCACAGCTGCTGAACAGGAAATTGTTCGTGACATTAAGGAGAGGATTGCGTATGTGGCCTTTGATTATGAGCAGGAAATTGAAACTGC TAAAAGTAGCTCATCAATTGAGAAGAGCCATGAACTACCTGATGGCCAGGTTATCTCCATTGGTACAGAGCTTTTCCATTGCCCTGAAGTCCCATTTCAA CCATCACTCATTGGCATGGAAGCACCTGGAATTCACGAAATCACATACGATTTGATCATGAAGTGTGAAAAGAAAGTACAGTCCTTGGATTAG
AA sequence Show only first row Show all	>Potri.001G453700.2 pacid=42791085 polypeptide=Potri.001G453700.2.p locus=Potri.001G453700 ID=Potri.001G453700.2.v4.1 annot-version=v4.1 MTEIMFEMFGVPDMYVAIGAELSLYASGRTTEIRHSFTTAAEQEIVRDIKERIAYVAFDYEQEIETAKSSSSIEKSHELPDGQVISIGTELFHCPEVPFQ PSLIGMEAPGIHEITYDLIMKCEKKVQSLD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G09810		ACT2/7, ACT7	actin 7 (.1)		Potri.001G453700 [exp]	0	1
AT1G25350		OVA9	ovule abortion 9, glutamine-tR...		Potri.010G122866 [exp]	12.56	0.8294
AT2G33720			AP2/B3-like transcriptional fa...		Potri.003G191901 [exp]	38.88	0.7262
AT3G07060		EMB1974	embryo defective 1974, NHL dom...		Potri.002G241366 [exp]	57.23	0.7843
AT3G60310			unknown protein		Potri.006G144600 [exp]	65.72	0.7383
AT5G36930			Disease resistance protein (TI...		Potri.019G016425 [exp]	80.01	0.7877
AT3G14470			NB-ARC domain-containing disea...		Potri.017G137700 [exp]	100.39	0.7759
AT1G03180			unknown protein		Potri.002G053801 [exp]	101.74	0.7489
AT5G54300			Protein of unknown function (D...		Potri.012G037001 [exp]	135.34	0.7660
AT3G20630		PER1, ATUBP14, ...	TITAN6, phosphate deficiency r...		Potri.001G408800 [exp]	143.66	0.7608	Pt-UBP14.2
AT1G26170			ARM repeat superfamily protein...		Potri.008G109300 [exp]	145.49	0.7617

Compare expression of checked genes

Potri.001G453700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.