Potri.001G453900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33140 332 / 1e-117 PGY2 PIGGYBACK2, Ribosomal protein L6 family (.1)
AT1G33120 332 / 1e-117 Ribosomal protein L6 family (.1)
AT4G10450 327 / 6e-116 Ribosomal protein L6 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G454101 391 / 3e-141 AT1G33140 331 / 1e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.001G454000 390 / 7e-141 AT1G33140 331 / 2e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.011G147700 382 / 8e-138 AT4G10450 331 / 2e-117 Ribosomal protein L6 family (.1)
Potri.011G148700 382 / 2e-137 AT1G33140 330 / 4e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.014G153000 44 / 2e-05 AT1G05190 338 / 3e-119 embryo defective 2394, Ribosomal protein L6 family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015588 361 / 4e-129 AT1G33140 350 / 4e-125 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10032962 357 / 8e-128 AT1G33140 345 / 4e-123 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10005286 357 / 9e-128 AT1G33140 347 / 1e-123 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10032918 303 / 9e-106 AT1G33140 301 / 9e-105 PIGGYBACK2, Ribosomal protein L6 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00347 Ribosomal_L6 Ribosomal protein L6
Representative CDS sequence
>Potri.001G453900.1 pacid=42788650 polypeptide=Potri.001G453900.1.p locus=Potri.001G453900 ID=Potri.001G453900.1.v4.1 annot-version=v4.1
ATGAAGACAATTCTGTCGTCCGAGACCATGGACATCCCGGACGGGGTGAAAATCAAGATCAGTGCTAGAATCATAGAAGTGGAAGGCCCAAGAGGCAAGC
TGAGCAGGAACTTCAAGCATTTGAATCTTGATTTTCAGCTGATCAAAGACGAGGAAGGGAAGAGAAAGCTCAAGATCGATGCCTGGTTTGCAACAAGAAA
GACCAGTGCTGCTATCAGGACTGCCCTGAGCCACGTGGAGAACTTGATTACTGGGGTTACCAAGGGGTACAGATACAAGATGAGGTTTGTGTATGCTCAC
TTTCCCATCAACGCTTCCATCACTAACAGCAACACTGCTATCGAGATCCGGAACTTTCTCGGCGAGAAGAAGGTTAGGAAGGTTGATATGCTTGACGGGG
TCAGTATTCTCCGATCTGAAAAGGTGAAGGATGAGCTCGTCCTAGATGGGAATGATATTGAGCTTGTTTCACGGTCGGCAGCTTTGATCAACCAGAAATG
TCATGTCAAGAACAAGGATATCCGAAAATTTCTTGATGGTATCTACGTGAGTGAGAAGGGCACTGTGGTTGAGGAAGAATGA
AA sequence
>Potri.001G453900.1 pacid=42788650 polypeptide=Potri.001G453900.1.p locus=Potri.001G453900 ID=Potri.001G453900.1.v4.1 annot-version=v4.1
MKTILSSETMDIPDGVKIKISARIIEVEGPRGKLSRNFKHLNLDFQLIKDEEGKRKLKIDAWFATRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAH
FPINASITNSNTAIEIRNFLGEKKVRKVDMLDGVSILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGTVVEEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G453900 0 1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454000 1.00 0.9794
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454101 1.41 0.9713
AT1G27400 Ribosomal protein L22p/L17e fa... Potri.012G096600 1.73 0.9664 Pt-RPL17.1
AT5G60390 GTP binding Elongation factor ... Potri.008G042500 2.82 0.9649 ADR12.1
AT3G20000 TOM40 translocase of the outer mitoc... Potri.014G004100 3.16 0.9626
AT4G16720 Ribosomal protein L23/L15e fam... Potri.014G057300 4.00 0.9542 Pt-RPL15.5
AT3G09630 Ribosomal protein L4/L1 family... Potri.016G084400 5.91 0.9568 Pt-RPL4.2
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Potri.008G110100 6.24 0.9361
AT5G52470 ATFIB1, ATFBR1,... SKP1/ASK1-INTERACTING PROTEIN,... Potri.015G147500 7.81 0.9079
AT4G12600 Ribosomal protein L7Ae/L30e/S1... Potri.013G116800 10.09 0.9118

Potri.001G453900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.