Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G13350 75 / 5e-17 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G04540 72 / 7e-16 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT2G33320 71 / 9e-16 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT4G01200 60 / 4e-12 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT3G04360 59 / 2e-11 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT5G23950 44 / 3e-06 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT4G15755 40 / 6e-05 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT3G16510 37 / 0.0008 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G172300 [exp] 77 / 1e-17 AT2G33320 265 / 8e-82 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.010G065300 [exp] 73 / 2e-16 AT2G13350 261 / 6e-83 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.019G021300 [exp] 71 / 6e-16 AT3G04360 213 / 2e-65 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.013G048400 [exp] 70 / 2e-15 AT2G33320 211 / 6e-63 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.002G166400 [exp] 63 / 5e-13 AT4G01200 211 / 4e-68 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.019G065500 [exp] 51 / 1e-08 AT2G40815 213 / 1e-66 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.001G108300 [exp] 45 / 7e-07 AT2G45760 59 / 7e-11 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Potri.010G024200 [exp] 38 / 0.0005 AT3G16510 135 / 5e-37 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.014G078700 [exp] 37 / 0.0006 AT2G45760 116 / 1e-32 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014466 [exp] 76 / 2e-17 AT1G04540 245 / 7e-76 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10003570 [exp] 73 / 2e-16 AT2G33320 222 / 7e-67 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10032780 [exp] 71 / 8e-16 AT2G33320 227 / 1e-70 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10008731 [exp] 61 / 3e-12 AT4G01200 222 / 3e-72 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10002155 [exp] 60 / 6e-12 AT4G01200 224 / 7e-73 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10024505 [exp] 55 / 2e-10 AT2G45760 58 / 3e-10 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Lus10008004 [exp] 53 / 1e-09 AT2G45760 56 / 1e-09 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Lus10030501 [exp] 42 / 2e-05 AT2G40815 168 / 4e-49 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10012856 [exp] 41 / 4e-05 AT1G76820 1211 / 0.0 eukaryotic translation initiation factor 2 (eIF-2) family protein (.1) Lus10006523 [exp] 41 / 4e-05 AT3G16510 147 / 1e-41 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0154 [poplar] [flax] C2 PF00168 [poplar] [flax] C2 C2 domain
Representative CDS sequence Show only first row Show all	>Potri.001G458101.1 pacid=42789811 polypeptide=Potri.001G458101.1.p locus=Potri.001G458101 ID=Potri.001G458101.1.v4.1 annot-version=v4.1 ATGGAGACATCTTCATTACGTAAAGCAATCATCATGGAGATCATTCTCATATCAGCACAAGAGCTCACGTCTATGAGCAACTCATCTTCAACTCCTGTGC AAACCTACGTGGTGGCCTACATCAACCCTAAGGAAAAGGTTGTCTCAAGAGTTGACAGAACCGGGAACACAAACCCTACTTGGAATGACAAGTTCGTTTT CTCTGTGGACGAAGAATTTGAGCACAGGAGGCCAAATTGTTGCTTGCTTTTGGAGATCTATAACGTTAGGAGATGTAGGAACATATCTTGCTTGAAGACT TGTTGA
AA sequence Show only first row Show all	>Potri.001G458101.1 pacid=42789811 polypeptide=Potri.001G458101.1.p locus=Potri.001G458101 ID=Potri.001G458101.1.v4.1 annot-version=v4.1 METSSLRKAIIMEIILISAQELTSMSNSSSTPVQTYVVAYINPKEKVVSRVDRTGNTNPTWNDKFVFSVDEEFEHRRPNCCLLLEIYNVRRCRNISCLKT C

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G13350			Calcium-dependent lipid-bindin...		Potri.001G458101 [exp]	0	1
AT4G15620			Uncharacterised protein family...		Potri.001G323700 [exp]	3.74	0.8892
AT3G04530		ATPPCK2, PEPCK2...	phosphoenolpyruvate carboxylas...		Potri.013G046100 [exp]	5.47	0.8774	Pt-PPCK2.1
AT1G17950	MYB	AtMYB52, BW52, ...	myb domain protein 52 (.1)		Potri.005G186400 [exp]	5.47	0.8660	MYB158,MYB.50
AT2G41760			unknown protein		Potri.006G051500 [exp]	14.28	0.8691
AT5G23750			Remorin family protein (.1.2)		Potri.001G107000 [exp]	15.65	0.8668
AT2G26850			F-box family protein (.1)		Potri.001G273900 [exp]	21.21	0.8148
AT2G33390			unknown protein		Potri.010G067200 [exp]	23.91	0.8068
AT2G18250		ATCOAD	4-phosphopantetheine adenylylt...		Potri.005G121200 [exp]	24.89	0.8148
AT5G46330		FLS2	FLAGELLIN-SENSITIVE 2, Leucine...		Potri.011G068500 [exp]	24.91	0.8429
					Potri.003G038525 [exp]	30.04	0.8222

Compare expression of checked genes

Potri.001G458101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.