Potri.001G458700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14540 394 / 3e-138 Peroxidase superfamily protein (.1)
AT1G14550 385 / 1e-134 Peroxidase superfamily protein (.1)
AT5G05340 360 / 1e-124 Peroxidase superfamily protein (.1)
AT5G58400 342 / 1e-117 Peroxidase superfamily protein (.1)
AT5G58390 308 / 2e-104 Peroxidase superfamily protein (.1)
AT5G06720 280 / 2e-93 ATPA2 peroxidase 2 (.1)
AT5G06730 273 / 5e-90 Peroxidase superfamily protein (.1)
AT1G44970 270 / 3e-89 Peroxidase superfamily protein (.1)
AT2G18150 270 / 4e-89 Peroxidase superfamily protein (.1)
AT4G36430 270 / 4e-89 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G458900 601 / 0 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1)
Potri.010G236890 419 / 3e-148 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1)
Potri.010G236870 414 / 5e-146 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.010G236900 412 / 4e-145 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.008G022248 405 / 1e-142 AT1G14540 404 / 3e-142 Peroxidase superfamily protein (.1)
Potri.008G022700 405 / 2e-142 AT1G14540 404 / 4e-142 Peroxidase superfamily protein (.1)
Potri.008G022232 404 / 5e-142 AT1G14550 401 / 6e-141 Peroxidase superfamily protein (.1)
Potri.010G236850 403 / 9e-142 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236910 403 / 9e-142 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024209 423 / 3e-149 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10009898 404 / 6e-142 AT1G14550 448 / 1e-159 Peroxidase superfamily protein (.1)
Lus10009902 401 / 5e-141 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1)
Lus10009900 398 / 1e-139 AT1G14550 436 / 1e-154 Peroxidase superfamily protein (.1)
Lus10024208 391 / 6e-137 AT1G14550 442 / 3e-157 Peroxidase superfamily protein (.1)
Lus10030148 332 / 2e-114 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10034207 330 / 6e-113 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10030149 327 / 5e-111 AT5G05340 405 / 8e-142 Peroxidase superfamily protein (.1)
Lus10009932 320 / 3e-107 AT5G05340 419 / 6e-146 Peroxidase superfamily protein (.1)
Lus10006534 310 / 5e-105 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.001G458700.1 pacid=42793621 polypeptide=Potri.001G458700.1.p locus=Potri.001G458700 ID=Potri.001G458700.1.v4.1 annot-version=v4.1
ATGGTTTCTCGTTTATCTTTAGCTTGTGTTGTTTTTTCATTATTCTTGATTTCCTCATGTTTTCCATGCCAAGCACAACTGTCTTCAAACTTCTATGACA
GCACATGTCCGAATGCACTGACCACAATTCGTACTGCTATTCGGAGAGCTGTCTCGAGCGAGCGCAGAATGGCAGCATCCCTTATTCGTCTTCACTTCCA
TGATTGCTTTGTTCAAGGTTGTGATGCTTCAATCATGCTTGACAATTCTCCTTCAATAGATAGCGAGAAATTCTCATTCAGCAATAACAATTCAATCCGG
GGATTTGAAGTCGTTGATGATGCCAAGGCTCAAGTGGAGAGCATATGTCCTGGAGTTGTTTCATGTGCTGACATTGCTGCTGTAGCAGCCCGTGATGCAT
CTGTTGCTGTTGGTGGACCATCATGGACAGTGAGGCTTGGAAGAAGGGACTCCACCACAGCAAGCCGAAGCCTAGCTGACAGCGATATTCCTAGAGCTAC
AACTAGCCTTGTAAACCTAATTGGCATGTTCAATGGAAAAGGTTTGAGTGAAAGAGATATGGTTGCCCTTTCAGGATCACATACAATAGGCCAAGCAAGA
TGTGTGACCTTCCGAGGCAGAATATATGACAATTCAAGTGATATTGATGCTGGTTTCGCCAGCACCAGAAGACGCAATTGTCCATCTGCTTCCGGTAACG
GAAATAATAATCTTGCTCCACTTGATTTGGTGACACCCAATTCTTTCGATAACAATTACTTCAGGAATCTCATTCAAAGGAGGGGGCTTCTTCAATCAGA
CCAAGTGCTCTTTAGTGGTCAATCTACAGACAGCATAGTCACCGAGTACAGCAGGAACCCTTCACTTTTTAGTTCTGATTTTGCCGCTGCCATGTTAAGG
ATGGGAGATATAGAACCACTGACTGGTTCTCAAGGAGAGATACGAAGGGTTTGCAGTGTTGTTAATTGA
AA sequence
>Potri.001G458700.1 pacid=42793621 polypeptide=Potri.001G458700.1.p locus=Potri.001G458700 ID=Potri.001G458700.1.v4.1 annot-version=v4.1
MVSRLSLACVVFSLFLISSCFPCQAQLSSNFYDSTCPNALTTIRTAIRRAVSSERRMAASLIRLHFHDCFVQGCDASIMLDNSPSIDSEKFSFSNNNSIR
GFEVVDDAKAQVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASRSLADSDIPRATTSLVNLIGMFNGKGLSERDMVALSGSHTIGQAR
CVTFRGRIYDNSSDIDAGFASTRRRNCPSASGNGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQVLFSGQSTDSIVTEYSRNPSLFSSDFAAAMLR
MGDIEPLTGSQGEIRRVCSVVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G14540 Peroxidase superfamily protein... Potri.001G458700 0 1
AT2G01900 DNAse I-like superfamily prote... Potri.010G101700 4.89 0.9734
AT5G05340 Peroxidase superfamily protein... Potri.006G107000 4.89 0.9624 PRX1.13
AT5G15180 Peroxidase superfamily protein... Potri.007G122351 12.64 0.9615
AT2G39380 ATEXO70H2 exocyst subunit exo70 family p... Potri.008G048700 14.42 0.9490
AT5G15180 Peroxidase superfamily protein... Potri.007G122301 14.49 0.9613
AT5G15180 Peroxidase superfamily protein... Potri.007G122250 18.13 0.9604
AT3G05640 Protein phosphatase 2C family ... Potri.010G006200 19.89 0.9597
AT2G28160 bHLH ATFIT1, ATBHLH2... ARABIDOPSIS FE-DEFICIENCY INDU... Potri.009G005600 20.97 0.9579
AT5G15180 Peroxidase superfamily protein... Potri.007G122401 24.00 0.9577
AT5G06070 C2H2ZnF RAB, RBE RABBIT EARS, C2H2 and C2HC zin... Potri.008G059000 26.15 0.9319

Potri.001G458700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.