Potri.001G459001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G459001.1 pacid=42787584 polypeptide=Potri.001G459001.1.p locus=Potri.001G459001 ID=Potri.001G459001.1.v4.1 annot-version=v4.1
ATGGAGAAGGTTTCGTTTTCAATGACATTCTTGTTCGTTTTGTTTGTCATCACAACTTGTGTTTCAATGTCGAACATACCAGTCGTCGAGGGAGGAGAAA
TTAAGCTAAATGTACCATGCAACACAACCGCAACTTGCCACCGAAAAACTTCTTGTCCAGGAAAGAGGATGGTTGTACGTTGTGTTCATAATTTTTGTCA
ATGTAATTGGTGA
AA sequence
>Potri.001G459001.1 pacid=42787584 polypeptide=Potri.001G459001.1.p locus=Potri.001G459001 ID=Potri.001G459001.1.v4.1 annot-version=v4.1
MEKVSFSMTFLFVLFVITTCVSMSNIPVVEGGEIKLNVPCNTTATCHRKTSCPGKRMVVRCVHNFCQCNW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G459001 0 1
AT2G46950 CYP709B2 "cytochrome P450, family 709, ... Potri.006G022200 1.00 0.9910 Pt-CYP709.2
AT5G67060 bHLH HEC1, bHLH088 HECATE 1, basic helix-loop-hel... Potri.007G044600 3.31 0.9656
AT1G37140 MCT1 MEI2 C-terminal RRM only like ... Potri.002G088200 4.24 0.9756
Potri.004G022300 5.47 0.9521
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Potri.010G042400 5.65 0.9813 Pt-INO.2
AT5G01600 ATFER1 ARABIDOPSIS THALIANA FERRETIN ... Potri.006G103900 6.48 0.9570
AT2G19210 Leucine-rich repeat transmembr... Potri.001G191701 6.78 0.9140
AT3G18010 HD WOX1 WUSCHEL related homeobox 1 (.1... Potri.010G111400 6.92 0.9612
AT1G75490 AP2_ERF DREB2D Integrase-type DNA-binding sup... Potri.002G029400 8.00 0.9774
AT1G04645 Plant self-incompatibility pro... Potri.018G148366 8.94 0.9737

Potri.001G459001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.