Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79620 109 / 2e-29 Leucine-rich repeat protein kinase family protein (.1) AT5G49760 101 / 1e-26 Leucine-rich repeat protein kinase family protein (.1) AT5G49770 92 / 4e-23 Leucine-rich repeat protein kinase family protein (.1) AT5G49780 89 / 4e-22 Leucine-rich repeat protein kinase family protein (.1) AT1G06840 85 / 1e-20 Leucine-rich repeat protein kinase family protein (.1) AT3G24550 84 / 2e-20 ATPERK1 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) AT5G01950 84 / 3e-20 Leucine-rich repeat protein kinase family protein (.1) AT5G37450 81 / 3e-19 Leucine-rich repeat protein kinase family protein (.1) AT1G52290 80 / 4e-19 AtPERK15 proline-rich extensin-like receptor kinase 15, Protein kinase superfamily protein (.1) AT4G04500 79 / 8e-19 CRK37 cysteine-rich RLK (RECEPTOR-like protein kinase) 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G231200 [exp] 157 / 3e-46 AT5G49760 759 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G231300 [exp] 157 / 4e-46 AT5G49760 719 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G231600 [exp] 154 / 3e-45 AT5G49760 763 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G231500 [exp] 149 / 2e-43 AT5G49760 800 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G232301 [exp] 147 / 8e-43 AT5G49760 750 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G231850 [exp] 127 / 8e-36 AT5G49760 914 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G231700 [exp] 127 / 1e-35 AT5G49760 1031 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G232400 [exp] 127 / 1e-35 AT5G49760 1013 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.016G144100 [exp] 118 / 1e-32 AT1G79620 1380 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012159 [exp] 123 / 4e-34 AT5G49760 1058 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10007587 [exp] 123 / 4e-34 AT5G49760 956 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10021003 [exp] 118 / 6e-33 AT1G79620 549 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10035605 [exp] 88 / 1e-21 AT5G01950 1126 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011098 [exp] 87 / 1e-21 AT3G24550 700 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) Lus10023645 [exp] 87 / 2e-21 AT3G24550 691 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) Lus10003244 [exp] 86 / 4e-21 AT5G01950 1039 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10043219 [exp] 85 / 1e-20 AT3G24550 688 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) Lus10002278 [exp] 84 / 2e-20 AT5G37450 722 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10034445 [exp] 82 / 1e-19 AT1G06840 1274 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.001G459300.1 pacid=42788931 polypeptide=Potri.001G459300.1.p locus=Potri.001G459300 ID=Potri.001G459300.1.v4.1 annot-version=v4.1 ATGGAAAACTTGTTGCAATTGTGTGGTAGAGTTCCTCAGTTGAAGGGAGCCAGACGCTTCTCTTTCGATGAGATTACGAAGAGCACCGATAATTTCTCAG AAGCCAATCATATTGGATCAGGGGGTTACAGAATGGTTTATAGAGGGATGCTTCCTACTGGACAACTGATTGCCATCAAACGATGTCGACAAGGATCGGT GCAAGGTGGGCTTGAATTCAACGCAGAGATGGAAGTTTTATCGAGAGTTCATCATAAAAATGTTGTAATTTAG
AA sequence Show only first row Show all	>Potri.001G459300.1 pacid=42788931 polypeptide=Potri.001G459300.1.p locus=Potri.001G459300 ID=Potri.001G459300.1.v4.1 annot-version=v4.1 MENLLQLCGRVPQLKGARRFSFDEITKSTDNFSEANHIGSGGYRMVYRGMLPTGQLIAIKRCRQGSVQGGLEFNAEMEVLSRVHHKNVVI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79620			Leucine-rich repeat protein ki...		Potri.001G459300 [exp]	0	1
					Potri.005G161366 [exp]	2.23	0.8364
AT1G32583			unknown protein		Potri.010G246300 [exp]	4.47	0.7629
AT5G19820		EMB2734	embryo defective 2734, ARM rep...		Potri.007G084100 [exp]	12.96	0.6977
AT4G04650			RNA-directed DNA polymerase (r...		Potri.007G061250 [exp]	14.45	0.6077
AT1G53050			Protein kinase superfamily pro...		Potri.005G086900 [exp]	16.24	0.6578
					Potri.007G048201 [exp]	30.59	0.5882
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Potri.019G061800 [exp]	38.78	0.6299
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G016400 [exp]	39.91	0.5752
AT5G05800			unknown protein		Potri.001G370432 [exp]	43.58	0.5990
AT3G22210			unknown protein		Potri.016G018650 [exp]	46.73	0.5730

Compare expression of checked genes

Potri.001G459300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.