Potri.001G460200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21105 117 / 1e-36 cytochrome-c oxidases;electron carriers (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G156400 124 / 1e-39 AT4G21105 117 / 2e-36 cytochrome-c oxidases;electron carriers (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006276 120 / 7e-38 AT4G21105 113 / 5e-35 cytochrome-c oxidases;electron carriers (.1.2)
Lus10020569 121 / 2e-37 AT4G21105 114 / 3e-34 cytochrome-c oxidases;electron carriers (.1.2)
Lus10006275 118 / 4e-37 AT4G21105 115 / 7e-36 cytochrome-c oxidases;electron carriers (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02238 COX7a Cytochrome c oxidase subunit VII
Representative CDS sequence
>Potri.001G460200.1 pacid=42791948 polypeptide=Potri.001G460200.1.p locus=Potri.001G460200 ID=Potri.001G460200.1.v4.1 annot-version=v4.1
ATGACAACAGAAGCACCTTTCCGACCAAGGGAGAAGCTCGTTGAGCACCAGAAATATTTCCAAAGCATTCACAAGCACACATATTTGAAGGGACCTCTTG
ATAAGGTTACCTCTGTTGCCATTCCAATAGCATTCGCAGCCACCTCACTTTTTCTTATTGGGCGAGGGATCTATAACATGTCTCATGGGATTGGAAAGAA
GGAATGA
AA sequence
>Potri.001G460200.1 pacid=42791948 polypeptide=Potri.001G460200.1.p locus=Potri.001G460200 ID=Potri.001G460200.1.v4.1 annot-version=v4.1
MTTEAPFRPREKLVEHQKYFQSIHKHTYLKGPLDKVTSVAIPIAFAATSLFLIGRGIYNMSHGIGKKE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G21105 cytochrome-c oxidases;electron... Potri.001G460200 0 1
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Potri.001G374000 1.41 0.8455 RAB11.4
AT3G11400 ATEIF3G1, EIF3G... eukaryotic translation initiat... Potri.010G199000 1.73 0.8373
AT1G76860 Small nuclear ribonucleoprotei... Potri.005G191600 2.00 0.8427
AT5G08060 unknown protein Potri.004G123700 2.64 0.8085
AT3G50360 CEN1, ATCEN2 CENTRIN 1, centrin2 (.1) Potri.005G138000 2.82 0.7822
AT5G06660 Protein of unknown function DU... Potri.016G060300 2.82 0.8246
AT5G09310 unknown protein Potri.005G063100 3.00 0.7736
AT4G24820 26S proteasome, regulatory sub... Potri.012G093500 3.87 0.8200
AT1G65650 UCH2 Peptidase C12, ubiquitin carbo... Potri.017G075200 5.65 0.7363
AT1G22920 CSN5A, JAB1, AJ... ARABIDOPSIS JAB1 HOMOLOG 1, CO... Potri.018G006100 6.24 0.7492 AJH1.3

Potri.001G460200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.