Potri.001G466132 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G466250 119 / 8e-37 ND /
Potri.015G021450 35 / 0.0006 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029106 47 / 5e-08 ND /
Lus10029107 39 / 4e-05 ND /
PFAM info
Representative CDS sequence
>Potri.001G466132.1 pacid=42789255 polypeptide=Potri.001G466132.1.p locus=Potri.001G466132 ID=Potri.001G466132.1.v4.1 annot-version=v4.1
ATGGAGAAGTCTTCATTCAAGCTAACTTTCTTGGTCTTTGCACTCTTAATCATCGCTTCTTGTTCACATGTAGGAGAAGCAAGAAGCACCGTGATTACAT
TACGTTGCAACAAAAATACAGACTGTGCAGGCCAAAGATGTTGGTGTATAGGCAAGAAATGTATGTGTAATACTTGTTTTTGTCAGAACCACAAGTGTGT
TTGTAAGGTTCAATCCTCCTTAAGCGATGCCATCATCGGAGCTCAAGTAGAAAAACCGGGACATTGA
AA sequence
>Potri.001G466132.1 pacid=42789255 polypeptide=Potri.001G466132.1.p locus=Potri.001G466132 ID=Potri.001G466132.1.v4.1 annot-version=v4.1
MEKSSFKLTFLVFALLIIASCSHVGEARSTVITLRCNKNTDCAGQRCWCIGKKCMCNTCFCQNHKCVCKVQSSLSDAIIGAQVEKPGH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G466132 0 1
AT1G29660 GDSL-like Lipase/Acylhydrolase... Potri.011G075900 1.00 0.9990
Potri.006G102050 26.00 0.9954
Potri.007G077350 27.16 0.8894
AT1G24260 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-... Potri.001G058400 28.63 0.9383
AT3G63420 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) Potri.005G216100 34.89 0.9407 Pt-AGG1.1
Potri.006G279850 35.91 0.8731
Potri.010G137500 37.38 0.8996
AT5G27660 Trypsin family protein with PD... Potri.018G001500 45.00 0.9112
Potri.001G031200 62.92 0.8666
AT5G03610 GDSL-like Lipase/Acylhydrolase... Potri.010G236951 64.48 0.8138

Potri.001G466132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.