Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G19830 72 / 4e-15 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 62 / 1e-11 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G13410 61 / 6e-11 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 55 / 8e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G10060 54 / 1e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48580 50 / 1e-07 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT1G73655 50 / 2e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G39710 49 / 6e-07 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT3G60370 49 / 7e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G119800 [exp] 79 / 6e-18 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.007G134600 [exp] 57 / 5e-10 AT2G43560 286 / 2e-98 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.017G017500 [exp] 56 / 3e-09 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.016G096600 [exp] 54 / 1e-08 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.014G045600 [exp] 53 / 2e-08 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G068300 [exp] 53 / 2e-08 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248200 [exp] 52 / 2e-08 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.012G129200 [exp] 48 / 2e-06 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.012G048300 [exp] 47 / 3e-06 AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027129 [exp] 242 / 2e-81 AT4G26555 246 / 5e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10032895 [exp] 246 / 4e-80 AT4G26550 338 / 8e-116 Got1/Sft2-like vescicle transport protein family (.1) Lus10036206 [exp] 68 / 5e-14 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038345 [exp] 68 / 7e-14 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10035560 [exp] 61 / 4e-11 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10008359 [exp] 57 / 8e-10 AT2G43560 273 / 1e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10027115 [exp] 57 / 9e-10 AT2G43560 276 / 5e-94 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10009828 [exp] 56 / 4e-09 AT5G13410 314 / 1e-108 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040937 [exp] 54 / 1e-08 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10025889 [exp] 52 / 2e-08 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.001G467100.2 pacid=42789008 polypeptide=Potri.001G467100.2.p locus=Potri.001G467100 ID=Potri.001G467100.2.v4.1 annot-version=v4.1 ATGATGTATGCACTTCCATTCCAAACCTTGCTTCACTTCCCTTGCGCTTCCAAATTTACAAGACCCAAGGATGCGATGCCCATGGACTTGCATTGCAAAT TTTCTTCACTAGAAATAAAAAGATTGTCAAGGAGGATGGTGCTGAAGTTTTGTGGATTCAATACTCTCCTATTGTCCATCAATCCAGTTTTGGCTGCCCC GATGCCAGAGATGAAGGAGCCTGAAGTTATTCGGACACTGAAGCTTGCCAGTGGGGTTAGGTTTCAAGAGATTATTGAAGGGGAAGGGCCGGAAGCTCAA GAGGGAGATACAGTTGAAGTTAACTATGTTTGCAGGCGTTCAAATGGATATTTTGTTCATAGCACCGTGGATCAATTCAGCGGCGAAAGCTCGCCTGTCA TACTTCCTTTGGATGAGAACCAGATTATTAAGGGCTTGAAGGAAGTCTTGATTGGCATGAAGGTTGGAGGTAAGAGAAGAGCATTGATACCTCCTTCTGT TGGATACGTAAATGAAAACTTGAAACCAATCCCTGATGAGTTTGGCCCTCGACGTAGCCTCTTCTCCCATGCAAATGAGCCTCTCATATTTGAAGTGCAG CTCTTGAAAGTCCTCTAA
AA sequence Show only first row Show all	>Potri.001G467100.2 pacid=42789008 polypeptide=Potri.001G467100.2.p locus=Potri.001G467100 ID=Potri.001G467100.2.v4.1 annot-version=v4.1 MMYALPFQTLLHFPCASKFTRPKDAMPMDLHCKFSSLEIKRLSRRMVLKFCGFNTLLLSINPVLAAPMPEMKEPEVIRTLKLASGVRFQEIIEGEGPEAQ EGDTVEVNYVCRRSNGYFVHSTVDQFSGESSPVILPLDENQIIKGLKEVLIGMKVGGKRRALIPPSVGYVNENLKPIPDEFGPRRSLFSHANEPLIFEVQ LLKVL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G26555			FKBP-like peptidyl-prolyl cis-...		Potri.001G467100 [exp]	0	1
AT4G37925		NdhM, NDH-M	NADH dehydrogenase-like comple...		Potri.002G077600 [exp]	1.00	0.9531
AT1G60550		ECHID, DHNS	enoyl-CoA hydratase/isomerase ...		Potri.001G329900 [exp]	3.46	0.9323
AT3G01480		ATCYP38, CYP38	ARABIDOPSIS CYCLOPHILIN 38, cy...		Potri.017G072800 [exp]	3.46	0.9439
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.006G258500 [exp]	5.91	0.9189
AT4G24750			Rhodanese/Cell cycle control p...		Potri.015G086100 [exp]	6.00	0.9077
AT2G43560			FKBP-like peptidyl-prolyl cis-...		Potri.007G134600 [exp]	6.63	0.9279
AT2G18300	bHLH	bHLH064, HBI1	basic helix-loop-helix (bHLH) ...		Potri.007G023600 [exp]	7.54	0.8948
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.006G258550 [exp]	7.74	0.9186
AT5G15140			Galactose mutarotase-like supe...		Potri.017G080000 [exp]	8.94	0.9134
AT4G19830			FKBP-like peptidyl-prolyl cis-...		Potri.012G119800 [exp]	9.94	0.9108

Compare expression of checked genes

Potri.001G467100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.