Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56020 72 / 1e-16 Got1/Sft2-like vescicle transport protein family (.1) AT4G26550 72 / 1e-16 Got1/Sft2-like vescicle transport protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G164900 [exp] 115 / 1e-33 AT5G56020 325 / 5e-114 Got1/Sft2-like vescicle transport protein family (.1) Potri.014G170700 [exp] 43 / 4e-06 AT4G26550 310 / 3e-108 Got1/Sft2-like vescicle transport protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027128 [exp] 77 / 1e-18 AT4G26550 333 / 3e-117 Got1/Sft2-like vescicle transport protein family (.1) Lus10032895 [exp] 65 / 1e-13 AT4G26550 338 / 8e-116 Got1/Sft2-like vescicle transport protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G467200.2 pacid=42788709 polypeptide=Potri.001G467200.2.p locus=Potri.001G467200 ID=Potri.001G467200.2.v4.1 annot-version=v4.1 ATGCAGAGTTGGTTTTCAAGCAGTGGAGAAGATCAACAACAAGAGAAACCCCCATCTTCTTTGTTGGCTGATTGGAACTCATATGCAGCAAAAAGCGATG TAAATGAATACACCAATGGATTAGGAAGCTTCGGTAGCTTTGATCTCGAAGCTGCTGTTCGCTCTGCTAACGACACCGTTTCTGGCACCTTTAATGTTTA CAACACAGAATTTCCTGGACCAGGGTTTGATTACTCCAGTCATGCAGCAGTGTCGCGTGGAATCAGTGGGAGCTGCCTATGA
AA sequence Show only first row Show all	>Potri.001G467200.2 pacid=42788709 polypeptide=Potri.001G467200.2.p locus=Potri.001G467200 ID=Potri.001G467200.2.v4.1 annot-version=v4.1 MQSWFSSSGEDQQQEKPPSSLLADWNSYAAKSDVNEYTNGLGSFGSFDLEAAVRSANDTVSGTFNVYNTEFPGPGFDYSSHAAVSRGISGSCL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G26550			Got1/Sft2-like vescicle transp...		Potri.001G467200 [exp]	0	1
AT1G61667			Protein of unknown function, D...		Potri.004G029600 [exp]	2.82	0.9254
AT5G24170			Got1/Sft2-like vescicle transp...		Potri.012G012700 [exp]	5.00	0.9013
AT5G49460		ACLB-2	ATP citrate lyase subunit B 2 ...		Potri.010G145832 [exp]	8.60	0.9073
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Potri.017G057500 [exp]	9.79	0.8885
AT5G23860		TUB8, b-TUB	tubulin beta 8 (.1.2)		Potri.016G107300 [exp]	12.48	0.9051
AT2G46225		ABIL1, ABI1L1	ABI-1-like 1 (.1.2.3)		Potri.018G082600 [exp]	19.79	0.8615
AT1G75280			NmrA-like negative transcripti...		Potri.005G228700 [exp]	19.79	0.8726	PCBER7
AT5G66060			2-oxoglutarate (2OG) and Fe(II...		Potri.007G060800 [exp]	20.61	0.8786
AT5G28150			Plant protein of unknown funct...		Potri.005G210800 [exp]	21.35	0.8607
					Potri.019G038142 [exp]	24.65	0.8688

Compare expression of checked genes

Potri.001G467200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.