Potri.001G468700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G55760 523 / 0 BTB/POZ domain-containing protein (.1)
AT1G21780 365 / 2e-126 BTB/POZ domain-containing protein (.1.2)
AT2G39760 76 / 2e-15 ATBPM3 BTB/POZ/MATH-domains containing protein (.1.2)
AT1G01640 74 / 3e-15 BTB/POZ domain-containing protein (.1.2)
AT3G56230 69 / 3e-13 BTB/POZ domain-containing protein (.1)
AT4G04090 68 / 3e-13 BTB/POZ domain-containing protein (.1)
AT3G03740 68 / 1e-12 ATBPM4 BTB-POZ and MATH domain 4 (.1)
AT2G40450 64 / 6e-12 BTB/POZ domain-containing protein (.1)
AT5G19000 65 / 2e-11 ATBPM1 BTB-POZ and MATH domain 1 (.1.2)
AT4G08455 64 / 2e-11 BTB/POZ domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G178400 367 / 2e-127 AT1G21780 543 / 0.0 BTB/POZ domain-containing protein (.1.2)
Potri.002G082800 360 / 2e-124 AT1G21780 535 / 0.0 BTB/POZ domain-containing protein (.1.2)
Potri.013G083800 72 / 4e-14 AT3G56230 305 / 2e-104 BTB/POZ domain-containing protein (.1)
Potri.010G029500 69 / 6e-13 AT3G06190 580 / 0.0 BTB-POZ and MATH domain 2 (.1.2)
Potri.002G077000 68 / 6e-13 AT4G08455 369 / 2e-130 BTB/POZ domain-containing protein (.1)
Potri.008G200700 68 / 1e-12 AT3G06190 582 / 0.0 BTB-POZ and MATH domain 2 (.1.2)
Potri.005G183600 64 / 1e-11 AT4G08455 342 / 2e-119 BTB/POZ domain-containing protein (.1)
Potri.019G039500 64 / 3e-11 AT3G03740 618 / 0.0 BTB-POZ and MATH domain 4 (.1)
Potri.004G194200 62 / 1e-10 AT3G03740 573 / 0.0 BTB-POZ and MATH domain 4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008348 579 / 0 AT1G55760 516 / 0.0 BTB/POZ domain-containing protein (.1)
Lus10027101 449 / 1e-159 AT1G55760 389 / 3e-136 BTB/POZ domain-containing protein (.1)
Lus10042717 373 / 1e-128 AT1G21780 557 / 0.0 BTB/POZ domain-containing protein (.1.2)
Lus10029677 360 / 2e-121 AT1G21780 538 / 0.0 BTB/POZ domain-containing protein (.1.2)
Lus10041235 69 / 3e-13 AT3G06190 339 / 8e-117 BTB-POZ and MATH domain 2 (.1.2)
Lus10021946 69 / 9e-13 AT3G06190 620 / 0.0 BTB-POZ and MATH domain 2 (.1.2)
Lus10042763 66 / 4e-12 AT4G08455 354 / 1e-124 BTB/POZ domain-containing protein (.1)
Lus10029732 65 / 7e-12 AT4G08455 354 / 2e-124 BTB/POZ domain-containing protein (.1)
Lus10040267 65 / 2e-11 AT2G39760 597 / 0.0 BTB/POZ/MATH-domains containing protein (.1.2)
Lus10004701 64 / 5e-11 AT2G39760 598 / 0.0 BTB/POZ/MATH-domains containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0033 POZ PF00651 BTB BTB/POZ domain
Representative CDS sequence
>Potri.001G468700.2 pacid=42789404 polypeptide=Potri.001G468700.2.p locus=Potri.001G468700 ID=Potri.001G468700.2.v4.1 annot-version=v4.1
ATGACAGATTCTTCTGCTTATAGAGTTGAAACCACTTCTCGTCTTGCTCAATGGAAGATAGACAATCTTGCTTCTTGTACTTATCGGAAATCAGATCCTT
TCAAGATTGGCAAGTGGAATTGGCATCTATCTGTGGAGAAGAACCGGGTATTATTTGTTAAGTTGTATCCAGAGATATCGAATCTAACGCGGGAAAATCC
TCCAATTGCTTCATTTATTATTCGAGTTGTTTCTTCTGCTGGAGATCGCAAGGCTTTGACTCATCCAGAGGTAACAGATAAGCAGCTCAAGAACAACGAG
GATTTCGTCTGGGCAATTGATGTTCCTTTAACAACAGGGAAATTCATTATCGACGTTGAATTCCTTGATTTGAAGGCAGCATCTCCAGGGGGTGGAGAAC
CTTGCTCGATCTGGGACGAAGAAACCACAGAAAAGCGAGCAAATGCAACAGCTCTTGTGTCACTTGGTAGAATGTTAACAGAAAGCATCCACACGGATAT
CAAAATTATTGTTTCTGATGGAAGCATTGGAGCCCACCGTGCTGTTCTTGCTGCAAGATCGCCTGTTTTCCACAGCATGTTTGCTCATGACCTGAAAGAA
AAGGAACTGTCAACCATAAATATCTCCGACATGTCAATTGAAGCTTGTCAGGCTTTTCTCAATTACATATATGGGAACATCCAGAGTGAAGAATTTCTTG
TCCACCGTTTGGCACTTCTCAGTGCAGCTGATAAGTATGATATTGCTGACCTGAAAGAGGCATGTCATGACAGTCTTCTGGAAGATATAGACACAAAGAA
TGTACTTGAGAGGCTACAAAGCGCATCCTTGTATCAATTGCCGAAACTGAAGACCAGCTGCCTGCGGTATCTTGTGAAGTTCGGTAAGATATTTGATATT
CGAGATGATTTCAATTCCTTCTTGCAATGTGCAGACAGGGATCTGATAGCTGAAGTCTTTCATGAAGTTCTCAATTCCTGGAAAGGATTCTGA
AA sequence
>Potri.001G468700.2 pacid=42789404 polypeptide=Potri.001G468700.2.p locus=Potri.001G468700 ID=Potri.001G468700.2.v4.1 annot-version=v4.1
MTDSSAYRVETTSRLAQWKIDNLASCTYRKSDPFKIGKWNWHLSVEKNRVLFVKLYPEISNLTRENPPIASFIIRVVSSAGDRKALTHPEVTDKQLKNNE
DFVWAIDVPLTTGKFIIDVEFLDLKAASPGGGEPCSIWDEETTEKRANATALVSLGRMLTESIHTDIKIIVSDGSIGAHRAVLAARSPVFHSMFAHDLKE
KELSTINISDMSIEACQAFLNYIYGNIQSEEFLVHRLALLSAADKYDIADLKEACHDSLLEDIDTKNVLERLQSASLYQLPKLKTSCLRYLVKFGKIFDI
RDDFNSFLQCADRDLIAEVFHEVLNSWKGF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G55760 BTB/POZ domain-containing prot... Potri.001G468700 0 1
AT2G32800 AP4.3A protein kinase family protein ... Potri.017G055000 1.73 0.8849
AT1G62400 HT1 high leaf temperature 1, Prote... Potri.012G080000 4.00 0.8621
AT5G41800 Transmembrane amino acid trans... Potri.003G138100 5.74 0.8591
AT1G15740 Leucine-rich repeat family pro... Potri.006G061700 5.83 0.8064
AT4G25433 peptidoglycan-binding LysM dom... Potri.012G135100 6.00 0.8459
AT5G42785 unknown protein Potri.002G034300 6.92 0.8398
AT1G08320 bZIP TGA9, bZIP21 TGACG \(TGA\) motif-binding pr... Potri.004G203400 7.48 0.8258
AT2G20030 RING/U-box superfamily protein... Potri.002G153400 7.93 0.7909
AT2G36210 SAUR-like auxin-responsive pro... Potri.006G211000 8.36 0.8300
AT5G05830 RING/FYVE/PHD zinc finger supe... Potri.004G059200 8.94 0.7579

Potri.001G468700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.