Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1) AT2G17880 86 / 1e-21 Chaperone DnaJ-domain superfamily protein (.1) AT4G36040 85 / 4e-21 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) AT4G13830 61 / 1e-11 J20 DNAJ-like 20 (.1.2) AT4G39960 61 / 2e-11 Molecular chaperone Hsp40/DnaJ family protein (.1) AT1G72070 57 / 6e-11 Chaperone DnaJ-domain superfamily protein (.1) AT2G22360 60 / 7e-11 DNAJ heat shock family protein (.1) AT4G37480 59 / 8e-11 Chaperone DnaJ-domain superfamily protein (.1) AT1G80030 59 / 9e-11 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3) AT2G35720 55 / 3e-09 OWL1 ORIENTATION UNDER VERY LOW FLUENCES OF LIGHT 1, DNAJ heat shock N-terminal domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G166500 [exp] 215 / 2e-72 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.007G107600 [exp] 142 / 4e-44 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.006G001301 [exp] 119 / 7e-35 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G113100 [exp] 95 / 2e-25 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020800 [exp] 95 / 4e-25 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G240700 [exp] 94 / 1e-24 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020700 [exp] 92 / 4e-24 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1) Potri.004G172300 [exp] 91 / 2e-23 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.009G131800 [exp] 82 / 1e-20 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032957 [exp] 109 / 4e-31 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1) Lus10017263 [exp] 92 / 6e-24 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10041906 [exp] 86 / 1e-21 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10034484 [exp] 83 / 5e-21 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10028453 [exp] 84 / 1e-20 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1) Lus10025060 [exp] 76 / 3e-18 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10013558 [exp] 68 / 1e-15 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10002355 [exp] 63 / 1e-12 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2) Lus10002356 [exp] 62 / 4e-12 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2) Lus10019668 [exp] 59 / 2e-11 AT4G13830 82 / 6e-20 DNAJ-like 20 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [poplar] [flax] Chaperone-J PF00226 [poplar] [flax] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Potri.001G469600.1 pacid=42791172 polypeptide=Potri.001G469600.1.p locus=Potri.001G469600 ID=Potri.001G469600.1.v4.1 annot-version=v4.1 ATGTATGCCATCTCTTCCACCCCCGCTCTAACCACCGCCGCAACGGCCGCGGCTACCGCCAATATAGTCCAAAAAACTTTCCTTCCATCGTCGATCACGA CATCCTCCACTCGTTCTCTCCGGGGATTTCGAATCAAGGCCTCGGTTTCAACGTTTCCTGACACTATCCGAGTAGACTCGAGGAATTCATCTCTGAGTCT GTACGAAATACTCCGGGTCAATCCAACCGCGTCGCAAGTGGAGATCAAGACTGCGTATAGAAGTCTTGCTAAGGTATACCATCCTGATGCGATGTTAGAT CGCGATGATGAGCCATCCGAAGGTGTTGATTTTATTGAGATTCACAACGCTTATGAGACGTTATCGGATCCGGCAGCGAGAGCGGTTTATGATATGTCTT TATCGGCAGCCGCGAGGGATTTTTATAGGAGAGCGGTTGGATATTCGGGTGGATATTATACGACCCGAAGATGGGAAACCGATCAGTGCTGGTAA
AA sequence Show only first row Show all	>Potri.001G469600.1 pacid=42791172 polypeptide=Potri.001G469600.1.p locus=Potri.001G469600 ID=Potri.001G469600.1.v4.1 annot-version=v4.1 MYAISSTPALTTAATAAATANIVQKTFLPSSITTSSTRSLRGFRIKASVSTFPDTIRVDSRNSSLSLYEILRVNPTASQVEIKTAYRSLAKVYHPDAMLD RDDEPSEGVDFIEIHNAYETLSDPAARAVYDMSLSAAARDFYRRAVGYSGGYYTTRRWETDQCW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13310			Chaperone DnaJ-domain superfam...		Potri.001G469600 [exp]	0	1
AT3G51100			unknown protein		Potri.005G117400 [exp]	4.24	0.5831
AT1G08315			ARM repeat superfamily protein...		Potri.001G028300 [exp]	4.35	0.6364
AT3G53490			unknown protein		Potri.016G081900 [exp]	10.53	0.5600
AT5G22950		VPS24.1	SNF7 family protein (.1)		Potri.004G215500 [exp]	27.56	0.5563
AT2G44140			Peptidase family C54 protein (...		Potri.017G000500 [exp]	32.84	0.5275
AT2G17030			F-box family protein with a do...		Potri.004G179685 [exp]	37.28	0.5538
AT2G27950			Ring/U-Box superfamily protein...		Potri.004G217700 [exp]	46.76	0.5341
AT2G10950			BSD domain-containing protein ...		Potri.018G125400 [exp]	65.23	0.5018
AT5G62020	HSF	AT-HSFB2A	ARABIDOPSIS THALIANA HEAT SHOC...		Potri.012G138900 [exp]	73.34	0.5146
AT2G40980			Protein kinase superfamily pro...		Potri.010G173100 [exp]	76.74	0.4963

Compare expression of checked genes

Potri.001G469600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.