Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PETF.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G60950 174 / 6e-57 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) AT1G10960 155 / 3e-49 ATFD1 ferredoxin 1 (.1) AT2G27510 141 / 1e-43 ATFD3 ferredoxin 3 (.1) AT5G10000 109 / 3e-31 ATFD4 ferredoxin 4 (.1) AT4G14890 75 / 1e-17 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) AT1G32550 66 / 4e-14 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G218400 [exp] 191 / 1e-63 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.003G015200 [exp] 186 / 2e-61 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.010G239100 [exp] 141 / 8e-44 AT2G27510 175 / 7e-57 ferredoxin 3 (.1) Potri.008G020100 [exp] 138 / 2e-42 AT2G27510 180 / 5e-59 ferredoxin 3 (.1) Potri.004G202500 [exp] 132 / 6e-40 AT2G27510 164 / 3e-52 ferredoxin 3 (.1) Potri.009G163800 [exp] 131 / 6e-40 AT2G27510 167 / 7e-54 ferredoxin 3 (.1) Potri.010G087300 [exp] 76 / 4e-18 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.008G153200 [exp] 69 / 2e-15 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.003G090400 [exp] 66 / 5e-14 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015462 [exp] 151 / 1e-47 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10001369 [exp] 147 / 4e-46 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10020616 [exp] 137 / 4e-42 AT2G27510 172 / 9e-56 ferredoxin 3 (.1) Lus10004870 [exp] 133 / 2e-40 AT2G27510 165 / 5e-53 ferredoxin 3 (.1) Lus10034144 [exp] 132 / 6e-40 AT2G27510 179 / 1e-58 ferredoxin 3 (.1) Lus10043430 [exp] 132 / 7e-40 AT2G27510 179 / 3e-58 ferredoxin 3 (.1) Lus10010557 [exp] 79 / 1e-18 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10006116 [exp] 75 / 8e-18 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10000483 [exp] 64 / 4e-13 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Lus10004576 [exp] 63 / 1e-12 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0486 [poplar] [flax] Fer2 PF00111 [poplar] [flax] Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence Show only first row Show all	>Potri.001G470700.1 pacid=42792526 polypeptide=Potri.001G470700.1.p locus=Potri.001G470700 ID=Potri.001G470700.1.v4.1 annot-version=v4.1 ATGGCCTCCACATCTGTAGCTGCCATGGCGAGCGCCTCTTTCACTCACCAAAAACCAGCTGTGACAAGCCCACGGCCGGCTCTTCCCAAGGTGGGGCAGT CTCTTTTTGGCTTAAAAGCCGGTCATAGAGGAGGACGTGTAAAGGCAATGGCAACATATTCAGTGAAGCTCATCACTCCTGATGGTGAAAAGGTGATTGA ATGCTCTGATGAAACCTACATCCTTGACAAGGCTGAAGAGGAAGGTATTGACCTTCCATACTCATGCAGGGCTGGTGCTTGCTCTTCATGTGCTGGGAAG ATCGTGGAAGGGATTGTGGATCAGTCTGATGCTAGCTTTCTTGGAGAAGACCAGATAGAGGCTGGTTGGGTTCTCACCTGTCTTGCTTATCCTAGGTCTG ATCTTGTCATCGAGACACATAAAGAGGAAGAGCTTGCTTCAAGTTAG
AA sequence Show only first row Show all	>Potri.001G470700.1 pacid=42792526 polypeptide=Potri.001G470700.1.p locus=Potri.001G470700 ID=Potri.001G470700.1.v4.1 annot-version=v4.1 MASTSVAAMASASFTHQKPAVTSPRPALPKVGQSLFGLKAGHRGGRVKAMATYSVKLITPDGEKVIECSDETYILDKAEEEGIDLPYSCRAGACSSCAGK IVEGIVDQSDASFLGEDQIEAGWVLTCLAYPRSDLVIETHKEEELASS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G60950		FED A, ATFD2, F...	FERREDOXIN 2, 2Fe-2S ferredoxi...		Potri.001G470700 [exp]	0	1	Pt-PETF.2
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.019G008402 [exp]	4.69	0.9870
AT5G49040			Disease resistance-responsive ...		Potri.001G023600 [exp]	8.00	0.9857
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Potri.003G192650 [exp]	12.12	0.9833
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Potri.005G175200 [exp]	12.72	0.9831
AT4G28780			GDSL-like Lipase/Acylhydrolase...		Potri.002G253400 [exp]	13.11	0.9842
AT4G08910			unknown protein		Potri.014G150900 [exp]	16.43	0.9828
AT1G07650			Leucine-rich repeat transmembr...		Potri.011G073066 [exp]	18.02	0.9815
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Potri.018G131400 [exp]	20.49	0.9808
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.019G014398 [exp]	21.23	0.9825
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Potri.011G140600 [exp]	22.22	0.9765

Compare expression of checked genes

Potri.001G470700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.