Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56230 115 / 3e-32 PRA1.G2 prenylated RAB acceptor 1.G2 (.1) AT1G55640 99 / 9e-26 PRA1.G1 prenylated RAB acceptor 1.G1 (.1) AT1G55190 74 / 2e-16 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G17700 68 / 2e-14 PRA1.F1 prenylated RAB acceptor 1.F1 (.1) AT2G40380 65 / 7e-13 PRA1.B2 prenylated RAB acceptor 1.B2 (.1) AT1G04260 64 / 7e-13 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1) AT3G13720 62 / 7e-12 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13710 61 / 2e-11 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT1G08770 60 / 4e-11 PRA1.E prenylated RAB acceptor 1.E (.1) AT3G56110 59 / 1e-10 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G219100 [exp] 76 / 3e-17 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 70 / 1e-14 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.003G035200 [exp] 61 / 1e-11 AT1G55190 161 / 2e-50 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.010G183300 [exp] 60 / 4e-11 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.019G124100 [exp] 60 / 4e-11 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.016G126400 [exp] 59 / 2e-10 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.002G044000 [exp] 57 / 6e-10 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.006G104400 [exp] 56 / 1e-09 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.002G043800 [exp] 54 / 5e-09 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005088 [exp] 71 / 4e-15 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10034363 [exp] 71 / 5e-15 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10026404 [exp] 70 / 1e-14 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10033859 [exp] 69 / 2e-14 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10042246 [exp] 69 / 4e-14 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10014747 [exp] 66 / 3e-13 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10021996 [exp] 60 / 5e-11 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1) Lus10012224 [exp] 57 / 4e-10 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1) Lus10042535 [exp] 57 / 5e-10 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1) Lus10015631 [exp] 57 / 7e-10 AT1G55190 193 / 7e-63 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [poplar] [flax] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Potri.001G472300.2 pacid=42789237 polypeptide=Potri.001G472300.2.p locus=Potri.001G472300 ID=Potri.001G472300.2.v4.1 annot-version=v4.1 ATGTCACAACCACCACCCCCCTCAACCACCACCACCTACACTACCATCCCCATCTCCGCCGGGGACGTGATTTCTCGGTCACTCCAAAACTTCACTTCCT CCTTCTCCATCCTCCGCCCCTGGCCCGAGCTCTTCACTTCCGGATCCTTCACCCGACCTGACTCATTCGCCACTGCCTTGACCCGACTCCGGGCCAATTT CCACCATTTCAGAGTCAATTACTCAATAATCATCTATGCTTGCGGAGCTTTATCTCTAATTGGGTCTCCATTTTCTCTCCTAATATTTTCTTCTGTGCTG TCTCTCTGGCTGCTCCTCTACTTCTTTAGAGAAGACCCATTGGTGTTATGGGGCTATGATGTGAGTGATCGCCTGGTTTTGATTGGTTTGGTTTTGGTTT CTGTTTTGGGTGTTTGGTTAAGCGGGGCAGCTTGGAATTTGGTTTGGGGTGTTCTGATTGGATTTTTGGTATGTGCGATTCATGCTGTATTGAGGAATTC AGATGGGTTGTTGGTTCCTGGCGAGGAAGCTGCTTTGGTCGGGTCAGGTTATGTGTCCGGGTCATATGGAGCTTTATCAGCATCTAGTGATGGTGGTGGT CAATTCATCAAGTAA
AA sequence Show only first row Show all	>Potri.001G472300.2 pacid=42789237 polypeptide=Potri.001G472300.2.p locus=Potri.001G472300 ID=Potri.001G472300.2.v4.1 annot-version=v4.1 MSQPPPPSTTTTYTTIPISAGDVISRSLQNFTSSFSILRPWPELFTSGSFTRPDSFATALTRLRANFHHFRVNYSIIIYACGALSLIGSPFSLLIFSSVL SLWLLLYFFREDPLVLWGYDVSDRLVLIGLVLVSVLGVWLSGAAWNLVWGVLIGFLVCAIHAVLRNSDGLLVPGEEAALVGSGYVSGSYGALSASSDGGG QFIK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G56230		PRA1.G2	prenylated RAB acceptor 1.G2 (...		Potri.001G472300 [exp]	0	1
AT4G00752			UBX domain-containing protein ...		Potri.014G075600 [exp]	5.56	0.8158
AT4G16447			unknown protein		Potri.014G165000 [exp]	6.24	0.7555
AT5G38630		ACYB-1	cytochrome B561-1 (.1)		Potri.017G111700 [exp]	7.21	0.8145
AT3G05936			unknown protein		Potri.005G000800 [exp]	8.36	0.7689
AT1G08390			unknown protein		Potri.004G190200 [exp]	8.66	0.8037
AT2G46170			Reticulon family protein (.1.2...		Potri.014G091200 [exp]	9.48	0.8066
					Potri.009G037500 [exp]	12.96	0.8005
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.001G236700 [exp]	13.71	0.8059	ADF1,Pt-ADF.5
AT3G16300			Uncharacterised protein family...		Potri.003G050400 [exp]	17.66	0.7631
AT5G28150			Plant protein of unknown funct...		Potri.005G050900 [exp]	18.54	0.7879

Compare expression of checked genes

Potri.001G472300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.