Plant FIBer expression Database

Potri.001G473250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G060100
[exp]
173 / 1e-57 ND /
Potri.006G126750
[exp]
166 / 2e-54 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G473250.1 pacid=42789917 polypeptide=Potri.001G473250.1.p locus=Potri.001G473250 ID=Potri.001G473250.1.v4.1 annot-version=v4.1
ATGATGAAAGCAAAAGTGAATACAATATCAAGTTCAGTAGACTTGATTGAAGGCTCTAGAAGAGCTAATATAATGCTTCCTAATGGAACAAGATTTATTA
TTGATAATGTTTTGTTCTCTACTAAATCAAGGAGAAATCTACTATGTTTCAAAGAAATACGACTTAATGGGTACTATATTGAAACTGTCAATGACAATGG
TATAGAATATCTTTACATCGTATCAAATGTCTCTACTAGAAAACAAACATTGAAAAAATTACTTGTTTTATCTTCAGGTTTGTACTACACAAGTATTAGT
ACAATCGAAGTCAATGCAAAATGA
AA sequence
>Potri.001G473250.1 pacid=42789917 polypeptide=Potri.001G473250.1.p locus=Potri.001G473250 ID=Potri.001G473250.1.v4.1 annot-version=v4.1
MMKAKVNTISSSVDLIEGSRRANIMLPNGTRFIIDNVLFSTKSRRNLLCFKEIRLNGYYIETVNDNGIEYLYIVSNVSTRKQTLKKLLVLSSGLYYTSIS
TIEVNAK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G473250
[exp]
0 1
AT4G32150 ATVAMP711, VAMP... vesicle-associated membrane pr... Potri.018G125900
[exp]
7.87 0.7522
AT1G04645 Plant self-incompatibility pro... Potri.018G148630
[exp]
9.64 0.7522
ATMG01270 ATMG01270.1, RP... mitochondrial ribosomal protei... Potri.007G061841
[exp]
11.66 0.6625
AT1G68510 AS2 LBD42 LOB domain-containing protein ... Potri.008G120600
[exp]
13.22 0.7376
AT2G34610 unknown protein Potri.011G083600
[exp]
15.29 0.6502
AT2G17950 HD WUS1, PGA6, WUS WUSCHEL 1, WUSCHEL, Homeodomai... Potri.007G012100
[exp]
18.70 0.6826
AT5G53550 ATYSL3, YSL3 YELLOW STRIPE like 3 (.1.2) Potri.012G027800
[exp]
21.42 0.6852
AT4G20820 FAD-binding Berberine family p... Potri.001G461700
[exp]
26.45 0.6573
AT5G41761 unknown protein Potri.012G031900
[exp]
26.70 0.6514
AT5G07050 nodulin MtN21 /EamA-like trans... Potri.012G007700
[exp]
27.34 0.6794

Potri.001G473250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.