Potri.002G000402 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G43760 54 / 7e-10 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G063901 79 / 1e-18 AT1G43760 266 / 1e-80 DNAse I-like superfamily protein (.1)
Potri.003G047001 79 / 2e-18 AT1G43760 265 / 5e-82 DNAse I-like superfamily protein (.1)
Potri.005G151275 78 / 3e-18 AT1G43760 268 / 1e-81 DNAse I-like superfamily protein (.1)
Potri.014G189001 58 / 6e-12 AT1G43760 66 / 4e-13 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G000402.1 pacid=42777816 polypeptide=Potri.002G000402.1.p locus=Potri.002G000402 ID=Potri.002G000402.1.v4.1 annot-version=v4.1
ATGAGAGCACCCTTCAAAGATGAGGAATTTAGGATTGCAATTTTCCAAATGGCACCTGATAAATCTCCGGGTCCAGATGGGTTGAATCCCAAATTCTATC
GGTGTTTCTGGTCACTGATTGGTCCAGAGGTGTGTAAGGCTTGTCGTAGCTGGTTGGAGAAGAAGGAATTTCCTCCTACATTAACTGACACGTTGGTAGT
GCTTATACCAAAGTGTGAAAGTCCACAAGCTATGCAAGAGCTTAGGCCGATTTCTTTATGTAATGTATTGTATTGTATAGGTTGA
AA sequence
>Potri.002G000402.1 pacid=42777816 polypeptide=Potri.002G000402.1.p locus=Potri.002G000402 ID=Potri.002G000402.1.v4.1 annot-version=v4.1
MRAPFKDEEFRIAIFQMAPDKSPGPDGLNPKFYRCFWSLIGPEVCKACRSWLEKKEFPPTLTDTLVVLIPKCESPQAMQELRPISLCNVLYCIG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G43760 DNAse I-like superfamily prote... Potri.002G000402 0 1
AT5G13270 RARE1 REQUIRED FOR ACCD RNA EDITING ... Potri.003G163701 1.73 0.9084
AT1G56350 Peptide chain release factor 2... Potri.013G009200 4.35 0.8616
AT1G73090 unknown protein Potri.010G250100 6.78 0.8955
AT5G52850 Pentatricopeptide repeat (PPR)... Potri.004G071800 8.12 0.8890
AT2G15530 RING/U-box superfamily protein... Potri.011G103301 8.83 0.8829
AT5G44230 Pentatricopeptide repeat (PPR)... Potri.005G119000 13.96 0.8698
AT1G03100 Pentatricopeptide repeat (PPR)... Potri.005G212400 14.14 0.8735
AT1G79220 Mitochondrial transcription te... Potri.007G069100 14.42 0.8565
AT3G58180 ARM repeat superfamily protein... Potri.002G041400 17.91 0.8080
AT5G40410 Tetratricopeptide repeat (TPR)... Potri.002G014800 18.16 0.8847

Potri.002G000402 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.