Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G43040 113 / 2e-33 SAUR-like auxin-responsive protein family (.1) AT5G42410 107 / 6e-31 SAUR-like auxin-responsive protein family (.1) AT1G79130 62 / 3e-13 SAUR-like auxin-responsive protein family (.1) AT1G56150 60 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT3G12830 61 / 2e-12 SAUR-like auxin-responsive protein family (.1) AT1G16510 57 / 4e-11 SAUR-like auxin-responsive protein family (.1) AT3G43120 55 / 4e-10 SAUR-like auxin-responsive protein family (.1) AT1G19840 54 / 5e-10 SAUR-like auxin-responsive protein family (.1) AT4G31320 54 / 9e-10 SAUR-like auxin-responsive protein family (.1) AT4G34750 54 / 1e-09 SAUR-like auxin-responsive protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G096400 [exp] 62 / 4e-13 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1) Potri.007G067800 [exp] 60 / 3e-12 AT3G12830 148 / 5e-47 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 59 / 7e-12 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 58 / 3e-11 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 57 / 3e-11 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.005G237000 [exp] 56 / 9e-11 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 56 / 2e-10 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.018G132400 [exp] 53 / 1e-09 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 52 / 2e-09 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034507 [exp] 59 / 2e-11 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 57 / 7e-11 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10031178 [exp] 57 / 8e-11 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 57 / 9e-11 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 56 / 2e-10 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2) Lus10031754 [exp] 55 / 2e-10 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1) Lus10026977 [exp] 55 / 4e-10 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 55 / 4e-10 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10018269 [exp] 55 / 9e-10 AT1G16510 92 / 4e-24 SAUR-like auxin-responsive protein family (.1) Lus10040643 [exp] 54 / 1e-09 AT1G16510 91 / 8e-24 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.002G000600.2 pacid=42776861 polypeptide=Potri.002G000600.2.p locus=Potri.002G000600 ID=Potri.002G000600.2.v4.1 annot-version=v4.1 ATGAGTGGAATCGTTAGAAAGCTATGGTGCTGCGGAGCAAAAGGGTTCCCGTCCGCAGACGACTCAGCTGAAGATCAGCTGGCACTACCCCCACCCGAGG GCCACGTTCGAGTGTGCGTTGGGAAAGACAATGTTCAGTGCAGGTTTGAGATGGAAGCCCATTTCTTAAACCATCCTCTATTTGAAGACCTGCTTCGTCT ATCTGAACAGGAGCATGGTTACGCTTACGATGGGGCTTTAAGGATTGCCTGCGAGATCCATCTCTTCCAATACCTTCTTCACCTCCTTAAGACTGGTAAT CCCACAGCACATTACATGCAACTTCCTGATCTCATTTCCACCTTCCACTCCAGTGCCGCCCACCACAAATATCCCCCCTTCCTCCTCCTCCTCCCCCGCT TCTAA
AA sequence Show only first row Show all	>Potri.002G000600.2 pacid=42776861 polypeptide=Potri.002G000600.2.p locus=Potri.002G000600 ID=Potri.002G000600.2.v4.1 annot-version=v4.1 MSGIVRKLWCCGAKGFPSADDSAEDQLALPPPEGHVRVCVGKDNVQCRFEMEAHFLNHPLFEDLLRLSEQEHGYAYDGALRIACEIHLFQYLLHLLKTGN PTAHYMQLPDLISTFHSSAAHHKYPPFLLLLPRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G43040			SAUR-like auxin-responsive pro...		Potri.002G000600 [exp]	0	1
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Potri.005G095250 [exp]	1.00	0.9925
AT1G11050			Protein kinase superfamily pro...		Potri.005G181800 [exp]	2.44	0.9907
AT5G37490			ARM repeat superfamily protein...		Potri.015G031000 [exp]	3.31	0.9772
AT1G08500		AtENODL18	early nodulin-like protein 18 ...		Potri.002G150600 [exp]	3.46	0.9772
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Potri.008G166700 [exp]	4.47	0.9851
AT1G53903			Protein of unknown function (D...		Potri.001G163400 [exp]	4.89	0.9841
AT5G43650	bHLH	BHLH92, bHLH092	basic helix-loop-helix (bHLH) ...		Potri.010G077000 [exp]	5.65	0.9808
					Potri.003G071050 [exp]	7.00	0.9820
AT4G08250	GRAS		GRAS family transcription fact...		Potri.005G190300 [exp]	7.21	0.9771	GRAS43
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Potri.014G046600 [exp]	8.36	0.9764

Compare expression of checked genes

Potri.002G000600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.