Potri.002G001800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17380 278 / 3e-97 AP19 associated protein 19 (.1)
AT4G35410 274 / 1e-95 Clathrin adaptor complex small chain family protein (.1.2)
AT1G47830 158 / 3e-50 SNARE-like superfamily protein (.1)
AT2G19790 120 / 3e-35 SNARE-like superfamily protein (.1)
AT3G50860 101 / 2e-27 Clathrin adaptor complex small chain family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G052000 276 / 3e-96 AT2G17380 307 / 6e-109 associated protein 19 (.1)
Potri.014G079000 271 / 1e-94 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2)
Potri.005G238701 162 / 1e-51 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1)
Potri.002G022900 158 / 3e-50 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1)
Potri.006G149100 120 / 2e-35 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.007G025400 106 / 2e-29 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Potri.005G122900 104 / 1e-28 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026316 287 / 1e-100 AT2G17380 297 / 7e-105 associated protein 19 (.1)
Lus10042352 288 / 2e-100 AT2G17380 297 / 3e-104 associated protein 19 (.1)
Lus10003641 223 / 2e-75 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2)
Lus10024337 157 / 8e-49 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1)
Lus10012924 119 / 1e-34 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
Lus10035004 113 / 2e-32 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1)
Lus10041742 100 / 7e-27 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1)
Lus10024011 83 / 4e-20 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Potri.002G001800.2 pacid=42779136 polypeptide=Potri.002G001800.2.p locus=Potri.002G001800 ID=Potri.002G001800.2.v4.1 annot-version=v4.1
ATGATTCACTTCGTGCTTCTTGTCAGTCGCCAGGGAAAGGTGAGGTTGGCCAAATGGTATTCCCCTTATACTCTGAGTGAAAGATCTAAGGTAGTACCGA
TCATCATGGATGCAAAACTCAATTTGTTAAGGACTGGACAGGTAATCCGAGAGCTGAGTGGCATCATTCTAAATCGGGGTCCCAAGCTTTGCAACTTCGT
GGAGTGGAGAGGATTTAGGGTTGTGTATAGAAGGTATGCTGGCCTCTATTTCTGCATGTGTGTTGATGAGAAAGACAACGAACTGGAGGTTCTTGATATC
ATTCATCATTATGTGGAGATACTGGATCGTTATTTTGGCAGTGTTTGTGAATTGGACTTGATCTTCAATTTCCACAAGGCGTATTATATTCTGGACGAAA
TCTTGATAGCCGGTGAGCTTCAAGAGTCAAGCAAGAGATCAGTGATACGGCTGGTGTGCACACATGATTCGTTGGTGGAGACGGCCAAGGAGCAGGCCAA
CTCGTTAAGCAGTGTGATTGCACAAGTTACCAAATAA
AA sequence
>Potri.002G001800.2 pacid=42779136 polypeptide=Potri.002G001800.2.p locus=Potri.002G001800 ID=Potri.002G001800.2.v4.1 annot-version=v4.1
MIHFVLLVSRQGKVRLAKWYSPYTLSERSKVVPIIMDAKLNLLRTGQVIRELSGIILNRGPKLCNFVEWRGFRVVYRRYAGLYFCMCVDEKDNELEVLDI
IHHYVEILDRYFGSVCELDLIFNFHKAYYILDEILIAGELQESSKRSVIRLVCTHDSLVETAKEQANSLSSVIAQVTK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G17380 AP19 associated protein 19 (.1) Potri.002G001800 0 1
AT5G22470 NAD+ ADP-ribosyltransferases;N... Potri.004G184100 13.03 0.9484
AT5G01030 Protein of unknown function (D... Potri.016G105500 18.86 0.9477
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Potri.010G250700 18.97 0.9149
AT5G14890 NHL domain-containing protein ... Potri.003G101300 21.35 0.9141
AT4G13640 GARP UNE16 unfertilized embryo sac 16, Ho... Potri.006G081001 22.84 0.9434
AT5G66110 HIPP27 heavy metal associated isopren... Potri.005G110400 25.29 0.9451
Potri.016G032550 29.10 0.9430
AT1G08520 V157, ALB1, ALB... PIGMENT DEFECTIVE EMBRYO 166, ... Potri.001G254308 32.40 0.9156
AT1G77780 Glycosyl hydrolase superfamily... Potri.010G088500 32.74 0.9424
Potri.014G170000 33.04 0.9278

Potri.002G001800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.