Potri.002G002501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20960 46 / 1e-06 EMB1507 embryo defective 1507, U5 small nuclear ribonucleoprotein helicase, putative (.1.2)
AT2G42270 39 / 0.0003 U5 small nuclear ribonucleoprotein helicase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G095500 61 / 9e-12 AT1G20960 3326 / 0.0 embryo defective 1507, U5 small nuclear ribonucleoprotein helicase, putative (.1.2)
Potri.012G097300 56 / 6e-10 AT1G20960 3440 / 0.0 embryo defective 1507, U5 small nuclear ribonucleoprotein helicase, putative (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025168 40 / 0.0002 AT1G20960 3286 / 0.0 embryo defective 1507, U5 small nuclear ribonucleoprotein helicase, putative (.1.2)
Lus10016048 40 / 0.0002 AT1G20960 3558 / 0.0 embryo defective 1507, U5 small nuclear ribonucleoprotein helicase, putative (.1.2)
PFAM info
Representative CDS sequence
>Potri.002G002501.1 pacid=42778425 polypeptide=Potri.002G002501.1.p locus=Potri.002G002501 ID=Potri.002G002501.1.v4.1 annot-version=v4.1
ATGAATCCATCCAACTTCAAGCTGTCGGGACATAACTTATCAATCCAAGCTGCTAAAGCCCTCATGCAAATAGCAAACTCCGTGCTCCAAAGTGGCCCTC
AACTTTTCTTCCTGAATCTTTTCAGTGAAAGGCTCCCATTCCATGGGGACCGTAGCAGAAAAGCTGGCTTTATCCACCATCCACGCTCGAGTATGTCATC
AGATCTATGGCATGTCAGGACAAAGCACCATATCTCTGGGGTCCTGATGATTATTTCACCCTTTTCAAGCAAGTGGCTATTTCCCCTGCAAACTCAACTA
TATGCCAAGACCTCTACCGAACTCTCTCCCCGCCACGATAGCACTCCTTGA
AA sequence
>Potri.002G002501.1 pacid=42778425 polypeptide=Potri.002G002501.1.p locus=Potri.002G002501 ID=Potri.002G002501.1.v4.1 annot-version=v4.1
MNPSNFKLSGHNLSIQAAKALMQIANSVLQSGPQLFFLNLFSERLPFHGDRSRKAGFIHHPRSSMSSDLWHVRTKHHISGVLMIISPFSSKWLFPLQTQL
YAKTSTELSPRHDSTP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Potri.002G002501 0 1
AT5G42340 PUB15 Plant U-Box 15 (.1) Potri.002G009900 14.86 0.8388
AT1G18280 Bifunctional inhibitor/lipid-t... Potri.015G036201 27.78 0.8288
AT1G09380 nodulin MtN21 /EamA-like trans... Potri.005G006600 35.07 0.8278
AT2G33670 ATMLO5, MLO5 MILDEW RESISTANCE LOCUS O 5, S... Potri.005G254800 37.62 0.8266
Potri.006G034450 40.29 0.8263
AT5G16460 Putative adipose-regulatory pr... Potri.013G085850 43.72 0.8204
AT5G20310 Adenine nucleotide alpha hydro... Potri.018G147200 44.09 0.8193
AT5G40140 RING/U-box superfamily protein... Potri.017G073400 52.75 0.8184
AT1G74875 unknown protein Potri.013G008800 55.64 0.8174
Potri.006G062050 80.93 0.8138

Potri.002G002501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.