Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76560 110 / 1e-31 CP12-3 CP12 domain-containing protein 3 (.1) AT3G62410 71 / 3e-16 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) AT2G47400 68 / 2e-15 CP12-1 CP12 domain-containing protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G258400 [exp] 157 / 3e-50 AT1G76560 114 / 1e-33 CP12 domain-containing protein 3 (.1) Potri.014G120700 [exp] 76 / 2e-18 AT3G62410 122 / 5e-37 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) Potri.002G196100 [exp] 73 / 3e-17 AT3G62410 89 / 8e-24 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001453 [exp] 71 / 1e-16 AT2G47400 126 / 1e-38 CP12 domain-containing protein 1 (.1) Lus10002428 [exp] 70 / 4e-16 AT2G47400 125 / 4e-38 CP12 domain-containing protein 1 (.1) Lus10025025 [exp] 69 / 1e-15 AT2G47400 125 / 2e-38 CP12 domain-containing protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02672 [poplar] [flax] CP12 CP12 domain
Representative CDS sequence Show only first row Show all	>Potri.002G002700.1 pacid=42778214 polypeptide=Potri.002G002700.1.p locus=Potri.002G002700 ID=Potri.002G002700.1.v4.1 annot-version=v4.1 ATGGCATCTCTGTCCATGATCCTGTCTTCATCTAATTTCTCATCAAGATCTGATGTTTTTGGCAACAAATTGTTCAACGGAAGATCTCTTGCTGTGAAGG GTACTGCGAGGGAGTGGGACGGTAGTAAGAGGGTTATGAAAGAGGCGAGGGTGAAGGCAAAAATGGGGGGAGGGGGGGGAGGAGGAGGAGGAGGAGTGGC AAAGTTCAAAGGGACCCAGATGAGAGAGAAGCAGCTGGCAGAGATGATAGAGAAGAAAGTCGTAGAAGCAAAGGAAGTGTGCGAGGGAGACGAGACATCA GACGAGTGCAAGGTGGCATGGGACGAAGTGGAGGAGGTGAGCCAAGCAAAGGCTGATTTCCGGCGCAGGTTGGAGAAACAGGATCCTCTCGAGTATTACT GTCAGGACAATCCTGAGACCGACGAGTGTCGTGTCTATGAAGATTGA
AA sequence Show only first row Show all	>Potri.002G002700.1 pacid=42778214 polypeptide=Potri.002G002700.1.p locus=Potri.002G002700 ID=Potri.002G002700.1.v4.1 annot-version=v4.1 MASLSMILSSSNFSSRSDVFGNKLFNGRSLAVKGTAREWDGSKRVMKEARVKAKMGGGGGGGGGGVAKFKGTQMREKQLAEMIEKKVVEAKEVCEGDETS DECKVAWDEVEEVSQAKADFRRRLEKQDPLEYYCQDNPETDECRVYED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G76560		CP12-3	CP12 domain-containing protein...		Potri.002G002700 [exp]	0	1
AT1G11700			Protein of unknown function, D...		Potri.004G015700 [exp]	1.00	0.7991
AT5G60850	DOF	OBP4, AtDof5. 4	OBF binding protein 4 (.1)		Potri.015G048300 [exp]	1.41	0.7901
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Potri.003G057400 [exp]	2.00	0.7716	Pt-LE.2
AT1G51700	DOF	ADOF1, AtDof1. ...	DOF zinc finger protein 1 (.1)		Potri.004G038800 [exp]	4.24	0.7536
AT4G34200		EDA9	embryo sac development arrest ...		Potri.002G122700 [exp]	4.58	0.7860
AT2G01680			Ankyrin repeat family protein ...		Potri.008G134500 [exp]	8.00	0.7372
AT4G14540	CCAAT	NF-YB3	"nuclear factor Y, subunit B3"...		Potri.016G006100 [exp]	8.00	0.7110
AT1G52190			Major facilitator superfamily ...		Potri.018G041800 [exp]	9.16	0.7374
AT1G70940		PIN3, ATPIN3	ARABIDOPSIS PIN-FORMED 3, Auxi...		Potri.010G112800 [exp]	13.03	0.6988	PIN3.1,PIN3
AT4G24150	GRF	ATGRF8	growth-regulating factor 8 (.1...		Potri.001G082700 [exp]	18.02	0.7189

Compare expression of checked genes

Potri.002G002700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.