Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33600 170 / 1e-52 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G33590 166 / 5e-51 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G76470 130 / 4e-37 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G58490 124 / 1e-34 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G09510 113 / 1e-30 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G09480 112 / 4e-30 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G02400 111 / 6e-30 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G09490 109 / 1e-29 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT5G19440 107 / 2e-28 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G51410 103 / 9e-27 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G257700 [exp] 236 / 2e-77 AT2G33590 400 / 4e-139 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G004100 [exp] 199 / 7e-64 AT2G33590 438 / 1e-155 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G004500 [exp] 154 / 2e-46 AT2G33590 364 / 2e-126 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.004G230900 [exp] 118 / 2e-32 AT2G02400 493 / 3e-177 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.001G045000 [exp] 116 / 9e-32 AT1G15950 484 / 3e-173 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.009G076300 [exp] 114 / 7e-31 AT5G58490 511 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.001G045500 [exp] 111 / 6e-30 AT1G15950 505 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.001G045100 [exp] 111 / 7e-30 AT1G15950 483 / 9e-173 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Potri.001G256400 [exp] 110 / 2e-29 AT5G19440 552 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012930 [exp] 193 / 6e-62 AT2G33590 360 / 1e-125 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024138 [exp] 184 / 6e-58 AT2G33590 420 / 2e-148 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10041651 [exp] 126 / 2e-35 AT1G15950 532 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Lus10024068 [exp] 125 / 3e-34 AT1G15950 534 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) Lus10042399 [exp] 119 / 1e-32 AT2G02400 457 / 7e-163 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10026385 [exp] 118 / 2e-32 AT5G58490 533 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10026273 [exp] 115 / 2e-31 AT2G02400 461 / 2e-164 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10039595 [exp] 109 / 5e-29 AT5G19440 462 / 6e-165 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10009955 [exp] 107 / 3e-28 AT1G51410 548 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024130 [exp] 107 / 2e-27 AT5G09860 933 / 0.0 nuclear matrix protein-related (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G003200.2 pacid=42779976 polypeptide=Potri.002G003200.2.p locus=Potri.002G003200 ID=Potri.002G003200.2.v4.1 annot-version=v4.1 ATGCAGAGGAGTCTTCCATGTGGCCAGCCCTGCTCCCGCTCCCTCCATTGCACTACCAAACCCCGAGTTGTGAGGAACCCAAACTGGCCCAAGGATCTAG TGATGGATGAGACATGTTGTTCTGATGAGGAACATTGCAGAACAACTGAGAATTGGTATAGTCTTTACAAAACAGAAGCAGAAAGTGAGGCTTGGGAATA CGCAAAAAGGACAGGGCTTGATGTTGTAGCAATTTGTCCAACCCTCATTTTAGGGCCAATTCTGCAGTCCACAGTTAATGCAAGTGCCAAGGCTCTTATT AAGATTTTGAAAGACGGGTGCAACTCATTGGAAAACGGGTTTCGGCTGATAGTAGATGCTCGTGATGTGGTTGAAGAGCAGGTTTTGGCATATGAGACGC CTGAGGCAAAAGGTAGATACATATGCATGGCGCACACAATCAAAGTTAAGGATTTAGTGGAGAAATTGAGGAGTACATATCATAACTACAATTATCCTAA AAGGTGA
AA sequence Show only first row Show all	>Potri.002G003200.2 pacid=42779976 polypeptide=Potri.002G003200.2.p locus=Potri.002G003200 ID=Potri.002G003200.2.v4.1 annot-version=v4.1 MQRSLPCGQPCSRSLHCTTKPRVVRNPNWPKDLVMDETCCSDEEHCRTTENWYSLYKTEAESEAWEYAKRTGLDVVAICPTLILGPILQSTVNASAKALI KILKDGCNSLENGFRLIVDARDVVEEQVLAYETPEAKGRYICMAHTIKVKDLVEKLRSTYHNYNYPKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G33600			NAD(P)-binding Rossmann-fold s...		Potri.002G003200 [exp]	0	1
AT1G06150	bHLH	bHLH089, EMB144...	EMBRYO DEFECTIVE 1444, basic h...		Potri.002G258766 [exp]	26.38	0.8423
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.012G024900 [exp]	46.33	0.8384
AT5G41750			Disease resistance protein (TI...		Potri.011G012851 [exp]	80.37	0.8190
AT5G06060			NAD(P)-binding Rossmann-fold s...		Potri.010G199700 [exp]	96.63	0.8250
AT1G05270			TraB family protein (.1)		Potri.007G121800 [exp]	99.27	0.7938
					Potri.018G131900 [exp]	101.43	0.8289
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.012G137550 [exp]	130.19	0.8129
AT5G01750			Protein of unknown function (D...		Potri.016G130800 [exp]	149.50	0.8180
AT2G36720			Acyl-CoA N-acyltransferase wit...		Potri.016G097300 [exp]	158.33	0.7987
AT2G31083		AtCLE5, CLE5, C...	CLAVATA3/ESR-RELATED 5 (.1)		Potri.001G376200 [exp]	170.31	0.8164

Compare expression of checked genes

Potri.002G003200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.