Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76410 177 / 1e-56 ATL8 RING/U-box superfamily protein (.1) AT1G20823 160 / 6e-50 RING/U-box superfamily protein (.1) AT2G17450 124 / 6e-36 RHA3A RING-H2 finger A3A (.1) AT4G35480 115 / 3e-32 RHA3B RING-H2 finger A3B (.1) AT5G05280 98 / 8e-26 RING/U-box superfamily protein (.1) AT3G18773 96 / 1e-24 RING/U-box superfamily protein (.1) AT1G49220 92 / 1e-22 RING/U-box superfamily protein (.1) AT1G49210 91 / 1e-22 RING/U-box superfamily protein (.1) AT1G49200 90 / 3e-22 RING/U-box superfamily protein (.1) AT3G10910 88 / 6e-22 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G255200 [exp] 231 / 7e-78 AT1G76410 163 / 2e-51 RING/U-box superfamily protein (.1) Potri.005G099000 [exp] 144 / 1e-43 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1) Potri.007G064401 [exp] 117 / 7e-33 AT1G20823 118 / 2e-33 RING/U-box superfamily protein (.1) Potri.001G309700 [exp] 98 / 2e-25 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1) Potri.016G136200 [exp] 96 / 8e-25 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1) Potri.019G010500 [exp] 96 / 2e-24 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1) Potri.001G309600 [exp] 96 / 2e-24 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1) Potri.019G057700 [exp] 94 / 4e-24 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1) Potri.019G130100 [exp] 93 / 1e-23 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030728 [exp] 204 / 7e-67 AT1G20823 209 / 6e-69 RING/U-box superfamily protein (.1) Lus10013210 [exp] 199 / 4e-65 AT1G20823 207 / 3e-68 RING/U-box superfamily protein (.1) Lus10016040 [exp] 186 / 1e-59 AT1G20823 202 / 4e-66 RING/U-box superfamily protein (.1) Lus10025162 [exp] 168 / 4e-53 AT1G20823 190 / 6e-62 RING/U-box superfamily protein (.1) Lus10005814 [exp] 105 / 3e-28 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1) Lus10006787 [exp] 105 / 3e-28 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1) Lus10005815 [exp] 104 / 9e-28 AT1G49230 170 / 3e-53 RING/U-box superfamily protein (.1) Lus10006788 [exp] 102 / 6e-27 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1) Lus10005817 [exp] 100 / 5e-26 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1) Lus10029037 [exp] 98 / 1e-25 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.002G006400.1 pacid=42779718 polypeptide=Potri.002G006400.1.p locus=Potri.002G006400 ID=Potri.002G006400.1.v4.1 annot-version=v4.1 ATGGCTCGTCCTTTCAGCTTCCTGAACGCCGTCGCGAACTCTTCGGCGACCACCACTGGGTCGCCTCCACAAGCATCAGCCACGGTGGACTCAGACTTCA TGGTCATACTAGCAGCACTCCTCTGCGCTCTAATTTGCGTTCTTGGCCTCATCGCTGTAGCTCGCTGCGCTTGGCTCCGCCGCTTCTCATCCCGGAATCC CACACCACCAGTTCCCCCTCCTCCTCCTTCTGTCGCCAACAAAGGGTTAAAAAAGAAAGTCCTCCGCTCTCTCCCTAAACAAACCTTCTCTGAAGATTTC TCCGGGAAACTCCCCGATTGTGCAATTTGCTTGACGGAATTCTCAGCTGGAGATGAAATCCGTGTGTTGCCTCAGTGTGGACATGGGTTTCATGTGAGCT GTATTGACACATGGCTTGGGTCTCACTCTTCTTGCCCTTCTTGCCGTCAGATTTTGGTGGTTGCCAGGTGTCAGAAGTGTGGTGGTTTGCCTTCAGGTTC GAGTTCTTCTAATGGTGGTGGTGGTGGTGGTGGTGGAGCTGAAACTGAAACTGAAGCTAGCCTAAAGGAGCGTGAAGATGGTGCTAATAGGTTCTTGCCC TAG
AA sequence Show only first row Show all	>Potri.002G006400.1 pacid=42779718 polypeptide=Potri.002G006400.1.p locus=Potri.002G006400 ID=Potri.002G006400.1.v4.1 annot-version=v4.1 MARPFSFLNAVANSSATTTGSPPQASATVDSDFMVILAALLCALICVLGLIAVARCAWLRRFSSRNPTPPVPPPPPSVANKGLKKKVLRSLPKQTFSEDF SGKLPDCAICLTEFSAGDEIRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCQKCGGLPSGSSSSNGGGGGGGGAETETEASLKEREDGANRFLP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G76410		ATL8	RING/U-box superfamily protein...		Potri.002G006400 [exp]	0	1
AT4G37240			unknown protein		Potri.004G149600 [exp]	2.23	0.8267
AT3G58060			Cation efflux family protein (...		Potri.001G010000 [exp]	9.16	0.7863
AT1G47990		ATGA2OX4	Arabidopsis thaliana gibberell...		Potri.008G101600 [exp]	9.79	0.8077	GA2.4
AT3G58060			Cation efflux family protein (...		Potri.001G010200 [exp]	12.96	0.7458
AT3G48990			AMP-dependent synthetase and l...		Potri.015G144700 [exp]	18.16	0.7140
AT2G45600			alpha/beta-Hydrolases superfam...		Potri.014G073100 [exp]	19.07	0.7805
AT4G32190			Myosin heavy chain-related pro...		Potri.018G026300 [exp]	20.90	0.7243
AT1G05675			UDP-Glycosyltransferase superf...		Potri.007G141900 [exp]	23.13	0.7719
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Potri.001G459400 [exp]	24.33	0.7268
AT5G06850			C2 calcium/lipid-binding plant...		Potri.006G058700 [exp]	32.68	0.7461

Compare expression of checked genes

Potri.002G006400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.