Potri.002G007601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G42480 62 / 5e-13 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G253600 106 / 2e-30 AT1G42480 201 / 2e-66 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030732 75 / 3e-18 AT1G42480 210 / 4e-70 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11938 DUF3456 TLR4 regulator and MIR-interacting MSAP
Representative CDS sequence
>Potri.002G007601.4 pacid=42778809 polypeptide=Potri.002G007601.4.p locus=Potri.002G007601 ID=Potri.002G007601.4.v4.1 annot-version=v4.1
ATGTGGAATTACTTCCTTTTCCCTGGTGAACTGGCCCACCCTGTTAGTTGTGATGCTGATGACAAGCAAGAAGCCAAGGCATATTCAAAAGATTTATCAT
CTTATTGTGGAAGGTTATTGGAGGAAACTGAAGATGAGTTGGCAGAACTGATAAAGAAAGGATCCGTGAAAGTAGGACGTTTGAGCAAGATTCTATGCCA
GGATTTGAGCAAGCACTGTAAGCAGTCAAGTGATTCCCATGAGGTGGATGCTGACGATGATGAACCAGATGGGGAACTATGA
AA sequence
>Potri.002G007601.4 pacid=42778809 polypeptide=Potri.002G007601.4.p locus=Potri.002G007601 ID=Potri.002G007601.4.v4.1 annot-version=v4.1
MWNYFLFPGELAHPVSCDADDKQEAKAYSKDLSSYCGRLLEETEDELAELIKKGSVKVGRLSKILCQDLSKHCKQSSDSHEVDADDDEPDGEL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G42480 unknown protein Potri.002G007601 0 1
Potri.006G177250 7.74 0.8037
AT3G45430 Concanavalin A-like lectin pro... Potri.009G035601 7.93 0.8010
AT1G03160 FZL FZO-like (.1.2) Potri.002G053366 11.61 0.7794
Potri.005G123600 14.21 0.8321
AT3G04970 DHHC-type zinc finger family p... Potri.005G041000 15.09 0.7229
AT5G48970 Mitochondrial substrate carrie... Potri.010G024100 15.81 0.7911
AT3G15160 unknown protein Potri.011G135800 24.08 0.7686
AT1G07350 SR45a serine/arginine rich-like prot... Potri.001G248100 26.53 0.7623
AT5G35520 MIS12, ATMIS12 MIS12 HOMOLOGUE, ARABIDOPSIS M... Potri.015G055500 27.83 0.6580
AT3G55830 EPC1 ECTOPICALLY PARTING CELLS, Nuc... Potri.010G191700 29.24 0.7723

Potri.002G007601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.