Potri.002G008050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G008050.1 pacid=42780060 polypeptide=Potri.002G008050.1.p locus=Potri.002G008050 ID=Potri.002G008050.1.v4.1 annot-version=v4.1
ATGACAGCGGTGGACAACACCGCCGTTGCAGAAATGAAATGGGAGGAGGGAAGTTGCCGATCCAGCCATCCACACGCCTGGTCTGCTGGCGGCGCGTGCA
ACGCCCGTCTCCAGATTTGGCAGATCGGAAGGAAGAAAAGCCGGACTGAAAACAAAGAAAAAGCTACAACAGACTTGCTTGCTGCGTTTGGTTGTTTTGC
AGGTAACGGTGGTGCCCATCGCCGGCGAAGAAAGGAAGAAGGGAGGAAGCCATTATGGATCTCCGCTGCCGCCCGGATTTCGCGGCGGCGCGTGGAGGAG
ACGCGCCGCCACTGTACACAATCACAGAAGATGCCCAGAGTGCTCCAGCACCGTTCCCGAAGCTTTTTGTAA
AA sequence
>Potri.002G008050.1 pacid=42780060 polypeptide=Potri.002G008050.1.p locus=Potri.002G008050 ID=Potri.002G008050.1.v4.1 annot-version=v4.1
MTAVDNTAVAEMKWEEGSCRSSHPHAWSAGGACNARLQIWQIGRKKSRTENKEKATTDLLAAFGCFAGNGGAHRRRRKEEGRKPLWISAAARISRRRVEE
TRRHCTQSQKMPRVLQHRSRSFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G008050 0 1
Potri.006G239650 8.24 0.8597
Potri.001G310801 14.28 0.8369
AT3G16510 Calcium-dependent lipid-bindin... Potri.013G107175 17.43 0.7480
AT5G36930 Disease resistance protein (TI... Potri.011G008612 18.16 0.8059
AT3G62240 C2H2ZnF RING/U-box superfamily protein... Potri.002G189700 21.56 0.7809
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Potri.005G026600 28.91 0.7930
AT5G41130 Esterase/lipase/thioesterase f... Potri.001G323800 33.46 0.8124
AT2G45680 TCP TCP9 TCP family transcription facto... Potri.003G120201 35.24 0.8084
Potri.017G152460 47.62 0.8020
Potri.008G130733 53.85 0.7917

Potri.002G008050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.