Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20760 56 / 2e-10 Calcium-binding EF hand family protein (.1) AT1G21630 37 / 0.0005 Calcium-binding EF hand family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G008600 [exp] 145 / 6e-42 AT1G20760 825 / 0.0 Calcium-binding EF hand family protein (.1) Potri.005G102200 [exp] 54 / 1e-09 AT1G21630 887 / 0.0 Calcium-binding EF hand family protein (.1.2) Potri.007G063200 [exp] 52 / 2e-09 AT1G20760 669 / 0.0 Calcium-binding EF hand family protein (.1) Potri.005G253000 [exp] 52 / 5e-09 AT1G20760 629 / 0.0 Calcium-binding EF hand family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016028 [exp] 91 / 8e-23 AT1G20760 770 / 0.0 Calcium-binding EF hand family protein (.1) Lus10012248 [exp] 91 / 1e-22 AT1G20760 886 / 0.0 Calcium-binding EF hand family protein (.1) Lus10016689 [exp] 39 / 0.0002 AT1G21630 806 / 0.0 Calcium-binding EF hand family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G008300.3 pacid=42779070 polypeptide=Potri.002G008300.3.p locus=Potri.002G008300 ID=Potri.002G008300.3.v4.1 annot-version=v4.1 ATGTCAAGATTTGGCAACTCTCCAAGGTTCAGCGAAGCAGGGGACCATTTTGACAATTACTCGAGATTTGATTCTTTCAGCATGAATGAAGGGGGCTTTT CACCACGAGAAGAGCTTACAAGGTTCGACTCCATAAACAGTTCCAAAGATTTTGGCCACAGTCGTGCATTCTCTTCATTTGATGATGGAGATCCATTTGG CTCCAGTGCCCCCTTTAAGGTTTCATCTGAAGATCAAACTACCAAAAAGAGTTCTGGCAATTGGAGTTCTTTCTAG
AA sequence Show only first row Show all	>Potri.002G008300.3 pacid=42779070 polypeptide=Potri.002G008300.3.p locus=Potri.002G008300 ID=Potri.002G008300.3.v4.1 annot-version=v4.1 MSRFGNSPRFSEAGDHFDNYSRFDSFSMNEGGFSPREELTRFDSINSSKDFGHSRAFSSFDDGDPFGSSAPFKVSSEDQTTKKSSGNWSSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G20760			Calcium-binding EF hand family...		Potri.002G008300 [exp]	0	1
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.013G029600 [exp]	3.16	0.9231
AT5G49720		TSD1, IRX2, DEC...	TUMOROUS SHOOT DEVELOPMENT 1, ...		Potri.001G078900 [exp]	4.47	0.9294	KOR1.2
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Potri.017G057500 [exp]	5.65	0.9044
AT5G04420			Galactose oxidase/kelch repeat...		Potri.008G030901 [exp]	6.32	0.9265
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Potri.014G066800 [exp]	7.48	0.9209	GOS12.1
AT1G67420			Zn-dependent exopeptidases sup...		Potri.008G175400 [exp]	8.48	0.9013
AT1G19110			inter-alpha-trypsin inhibitor ...		Potri.003G068000 [exp]	8.77	0.8792
AT3G29170			Eukaryotic protein of unknown ...		Potri.016G054301 [exp]	12.40	0.8631
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.015G104700 [exp]	12.48	0.9086
AT2G19790			SNARE-like superfamily protein...		Potri.006G149100 [exp]	12.96	0.8997

Compare expression of checked genes

Potri.002G008300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.