Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12740 132 / 6e-38 CYP87A2 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) AT1G55940 131 / 7e-37 CYP708A1 "cytochrome P450, family 708, subfamily A, polypeptide 1", cytochrome P450, family 708, subfamily A, polypeptide 1 (.1) AT3G44970 129 / 1e-36 Cytochrome P450 superfamily protein (.1) AT5G48000 123 / 2e-34 THAH1, THAH, CYP708A2 THALIANOL HYDROXYLASE 1, THALIANOL HYDROXYLASE, "cytochrome P450, family 708, subfamily A, polypeptide 2", cytochrome P450, family 708, subfamily A, polypeptide 2 (.1.2.3.4.5) AT1G78490 122 / 3e-34 CYP708A3 "cytochrome P450, family 708, subfamily A, polypeptide 3", cytochrome P450, family 708, subfamily A, polypeptide 3 (.1) AT4G36380 110 / 2e-29 ROT3 ROTUNDIFOLIA 3, Cytochrome P450 superfamily protein (.1) AT5G05690 107 / 3e-29 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT4G15300 102 / 1e-26 CYP702A2 "cytochrome P450, family 702, subfamily A, polypeptide 2", cytochrome P450, family 702, subfamily A, polypeptide 2 (.1) AT3G50660 99 / 2e-25 PSC1, CYP90B1, CLM, SNP2, DWF4, SAV1 SUPPRESSOR OF NPH4 2, SHADE AVOIDANCE 1, PARTIALLY SUPPRESSING COI1 INSENSITIVITY TO JA 1, DWARF 4, CYTOCHROME P450 90B1, CLOMAZONE-RESISTANT, Cytochrome P450 superfamily protein (.1) AT4G15393 99 / 2e-25 CYP702A5 "cytochrome P450, family 702, subfamily A, polypeptide 5", cytochrome P450, family 702, subfamily A, polypeptide 5 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G270700 [exp] 155 / 1e-46 AT1G12740 455 / 1e-157 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.009G143600 [exp] 150 / 1e-44 AT1G12740 475 / 3e-165 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.009G064900 [exp] 149 / 2e-44 AT1G12740 477 / 5e-166 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.009G064800 [exp] 149 / 5e-44 AT1G12740 452 / 2e-156 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.004G183800 [exp] 148 / 7e-44 AT1G12740 476 / 1e-165 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G270400 [exp] 147 / 2e-43 AT1G12740 442 / 2e-152 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G270300 [exp] 147 / 2e-43 AT1G12740 437 / 2e-150 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G270800 [exp] 147 / 2e-43 AT1G12740 488 / 2e-170 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G270500 [exp] 147 / 2e-43 AT1G12740 443 / 1e-152 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024495 [exp] 139 / 1e-40 AT1G12740 751 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10028628 [exp] 136 / 2e-39 AT1G12740 360 / 9e-121 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10042788 [exp] 123 / 3e-34 AT1G12740 397 / 1e-134 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10027434 [exp] 121 / 1e-33 AT1G12740 342 / 3e-113 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10013060 [exp] 117 / 2e-32 AT3G44970 148 / 5e-40 Cytochrome P450 superfamily protein (.1) Lus10028297 [exp] 111 / 5e-31 AT5G05690 472 / 2e-168 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10040193 [exp] 113 / 1e-30 AT5G05690 687 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10005762 [exp] 107 / 1e-28 AT1G12740 429 / 1e-146 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10030404 [exp] 106 / 2e-28 AT5G05690 531 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10041794 [exp] 106 / 4e-28 AT4G36380 643 / 0.0 ROTUNDIFOLIA 3, Cytochrome P450 superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.002G010532.1 pacid=42778795 polypeptide=Potri.002G010532.1.p locus=Potri.002G010532 ID=Potri.002G010532.1.v4.1 annot-version=v4.1 ATGACCTATACCCATCATGTTGTTAACGAATCACTCAGGTTGGCAAGTGTTGCTCCAGGAATGCTTAGAAGGGCCATAAAAGACATTCAAGTTGAAGGAT ACACAATCCCTAAAGGCTGGACTATCATGGTTGTTCTAGCAGCTGTTCAATTAAATCCCAACACCTACAAAGATCCCCTTGCCTTTGATCCATCAAGATG GGATAACACGGGAGCTATTGCAACTGCAAAGAACTTCATAGCTTTTGGAGGAGGCTTAAGGTCATGTGCTGGAGCAGAGTTCAGTAGGGTTTTGATGCCT GTATTCTTACATTTCTTAGTCGCCAAATAG
AA sequence Show only first row Show all	>Potri.002G010532.1 pacid=42778795 polypeptide=Potri.002G010532.1.p locus=Potri.002G010532 ID=Potri.002G010532.1.v4.1 annot-version=v4.1 MTYTHHVVNESLRLASVAPGMLRRAIKDIQVEGYTIPKGWTIMVVLAAVQLNPNTYKDPLAFDPSRWDNTGAIATAKNFIAFGGGLRSCAGAEFSRVLMP VFLHFLVAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.002G010532 [exp]	0	1
AT1G45110			Tetrapyrrole (Corrin/Porphyrin...		Potri.005G232200 [exp]	2.44	0.8650
AT3G06560		PAPS3	poly(A) polymerase 3 (.1)		Potri.008G102500 [exp]	3.87	0.8411
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.002G010466 [exp]	4.58	0.8111
AT5G22860			Serine carboxypeptidase S28 fa...		Potri.001G213400 [exp]	6.00	0.8194
AT5G63520			unknown protein		Potri.015G098700 [exp]	7.93	0.8070
AT4G21215			unknown protein		Potri.004G023000 [exp]	8.94	0.7539
AT2G47350			HIT zinc finger ;PAPA-1-like c...		Potri.013G008300 [exp]	14.83	0.8349
AT2G39190		ATATH8	Protein kinase superfamily pro...		Potri.010G221000 [exp]	15.16	0.8332
AT1G14205			Ribosomal L18p/L5e family prot...		Potri.008G087100 [exp]	15.23	0.8095
AT3G57710			Protein kinase superfamily pro...		Potri.005G068000 [exp]	21.90	0.7804

Compare expression of checked genes

Potri.002G010532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.