Potri.002G011750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G011750.1 pacid=42777244 polypeptide=Potri.002G011750.1.p locus=Potri.002G011750 ID=Potri.002G011750.1.v4.1 annot-version=v4.1
ATGCCTTTTCTAACACATGGTATGGTTGGGAGTGCAAGTATTTCTTGCATTTGGAATATTGGCCAATCAGCATATCCATCTCCAATTCCTCGGAAAGGGA
CCGGCTGGTCCAAGGCCACTGAACCTTATTTGGTTTGTCCCGATGCAAGACTAATTCTGTCAAGCAACCCCCAAGAGATCAAGCCACCACCGAAGCAATT
TTTTCGCAAAACCAGAACGATACAGAGGAAGCACCAGCTTTACGACTATTCGAAGAAGAGATTTCGTCTAATTATCAGTTAA
AA sequence
>Potri.002G011750.1 pacid=42777244 polypeptide=Potri.002G011750.1.p locus=Potri.002G011750 ID=Potri.002G011750.1.v4.1 annot-version=v4.1
MPFLTHGMVGSASISCIWNIGQSAYPSPIPRKGTGWSKATEPYLVCPDARLILSSNPQEIKPPPKQFFRKTRTIQRKHQLYDYSKKRFRLIIS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G011750 0 1
AT5G66980 B3 AP2/B3-like transcriptional fa... Potri.007G035500 6.63 0.8605
AT1G48140 DPMS3 dolichol phosphate mannose syn... Potri.002G245800 13.85 0.8440
AT2G31690 alpha/beta-Hydrolases superfam... Potri.014G150700 17.83 0.8500
AT3G13430 RING/U-box superfamily protein... Potri.017G102800 18.97 0.8489
AT1G06930 unknown protein Potri.019G127400 24.41 0.8489
AT5G66150 Glycosyl hydrolase family 38 p... Potri.007G056300 36.49 0.7522
AT5G11390 WIT1 WPP domain-interacting protein... Potri.004G111350 40.13 0.8395
AT1G03180 unknown protein Potri.005G208700 41.59 0.8382
AT5G20940 Glycosyl hydrolase family prot... Potri.009G154032 44.37 0.8378
AT1G53820 RING/U-box superfamily protein... Potri.001G162000 45.23 0.8297 Pt-ATL3.2

Potri.002G011750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.