Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44265 68 / 2e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51600 59 / 4e-12 LTP5 lipid transfer protein 5 (.1) AT5G59320 55 / 1e-10 LTP3 lipid transfer protein 3 (.1) AT4G28395 56 / 3e-10 ATA7 ARABIDOPSIS THALIANA ANTHER 7, ANTHER 7, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G38540 48 / 6e-08 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59310 45 / 4e-07 LTP4 lipid transfer protein 4 (.1) AT3G51590 42 / 1e-05 LTP12 lipid transfer protein 12 (.1) AT2G38530 41 / 2e-05 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G013200 [exp] 75 / 2e-18 AT5G44265 106 / 1e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.007G138400 [exp] 55 / 1e-10 AT5G44265 76 / 8e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.007G138500 [exp] 54 / 2e-10 AT5G44265 77 / 4e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 45 / 6e-07 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.016G135400 [exp] 42 / 6e-06 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.014G098000 [exp] 42 / 8e-06 AT5G59310 71 / 9e-17 lipid transfer protein 4 (.1) Potri.014G046500 [exp] 42 / 9e-06 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033667 [exp] 70 / 3e-16 AT5G44265 52 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017710 [exp] 67 / 7e-15 AT5G44265 54 / 8e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028002 [exp] 50 / 1e-08 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028003 [exp] 50 / 1e-08 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028055 [exp] 47 / 2e-07 AT5G59310 66 / 9e-15 lipid transfer protein 4 (.1) Lus10012392 [exp] 47 / 2e-07 AT4G33355 69 / 8e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10012384 [exp] 45 / 6e-07 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10015278 [exp] 44 / 1e-06 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10015279 [exp] 43 / 4e-06 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10012383 [exp] 43 / 6e-06 AT5G59310 64 / 4e-14 lipid transfer protein 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G012300.1 pacid=42777321 polypeptide=Potri.002G012300.1.p locus=Potri.002G012300 ID=Potri.002G012300.1.v4.1 annot-version=v4.1 ATGGCTGCCTTTGTTAGGAGTCTAGTGCTTGCCCTCATGGTTTCTAGATTCATCACTATAATGGCATCCGACGACGACCCTTATGACGCAATATGCTCGC CGATATGGGGTTACTTCCCTGACTGTGCTGAGTATTTGGGAGGTTTAAGCCATCACCTGCCGAAAAAATGCTGTCACAGCATCAGAAAGCTCAATGAAAT TGCTAAGAAAACCAAAAAGGGACCAAAGGTGGTCTGCTTTTGCATTGAAGCCTTCATGGTTCCTCAAGATTTTCACTTAAAACCTTCACGAATCAAAAAG CTACCAAAGAAGTGCCACACAGATATTCTTTTCCCGATTTCTGAAACAATGAACTGCTCGTTTGACGAGCGTTGA
AA sequence Show only first row Show all	>Potri.002G012300.1 pacid=42777321 polypeptide=Potri.002G012300.1.p locus=Potri.002G012300 ID=Potri.002G012300.1.v4.1 annot-version=v4.1 MAAFVRSLVLALMVSRFITIMASDDDPYDAICSPIWGYFPDCAEYLGGLSHHLPKKCCHSIRKLNEIAKKTKKGPKVVCFCIEAFMVPQDFHLKPSRIKK LPKKCHTDILFPISETMNCSFDER

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G44265			Bifunctional inhibitor/lipid-t...		Potri.002G012300 [exp]	0	1
AT3G20190			Leucine-rich repeat protein ki...		Potri.014G002700 [exp]	4.24	0.6916
AT4G19110			Protein kinase superfamily pro...		Potri.010G154400 [exp]	6.24	0.6310
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Potri.015G077700 [exp]	11.83	0.6130
					Potri.005G157601 [exp]	13.41	0.6325
					Potri.004G151301 [exp]	14.38	0.6390
AT5G26330			Cupredoxin superfamily protein...		Potri.002G052500 [exp]	15.96	0.5558
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Potri.003G195150 [exp]	16.43	0.6169
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Potri.001G125600 [exp]	17.88	0.5276	GF14.2
					Potri.011G164750 [exp]	19.33	0.6183
AT3G23130	C2H2ZnF	FLO10, FON1, SU...	SUPERMAN, FLORAL ORGAN NUMBER ...		Potri.010G074500 [exp]	29.15	0.5862	FLO10.1

Compare expression of checked genes

Potri.002G012300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.