Plant FIBer expression Database

Potri.002G012700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76200 91 / 2e-26 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G248600
[exp]
114 / 3e-35 AT1G76200 91 / 3e-26 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034571
[exp]
108 / 3e-33 AT1G76200 94 / 2e-27 unknown protein
Lus10016001
[exp]
106 / 2e-32 AT1G76200 91 / 2e-26 unknown protein
Lus10012279
[exp]
94 / 7e-26 AT1G76200 79 / 1e-19 unknown protein
PFAM info
Representative CDS sequence
>Potri.002G012700.1 pacid=42779814 polypeptide=Potri.002G012700.1.p locus=Potri.002G012700 ID=Potri.002G012700.1.v4.1 annot-version=v4.1
ATGGCAGGAGGGCATGGAGAGGGTTTCGCTTACAAGGGCTTGACTATGCATAAGCCAAAGCGATGGCATACTGTAACTGGAAAGGGCTTGTGTGCTGTCA
TGTGGTTTTGGGTCTTGTACCGGGCTAAACAAGATGGTCCTGTAGTATTGGGCTGGCGGCATCCGTGGGAGGGCCATGATGATCATGGCCATGGACATGG
GCACTAG
AA sequence
>Potri.002G012700.1 pacid=42779814 polypeptide=Potri.002G012700.1.p locus=Potri.002G012700 ID=Potri.002G012700.1.v4.1 annot-version=v4.1
MAGGHGEGFAYKGLTMHKPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWEGHDDHGHGHGH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G76200 unknown protein Potri.002G012700
[exp]
0 1
AT1G68370 ARG1 ALTERED RESPONSE TO GRAVITY 1,... Potri.010G122300
[exp]
4.69 0.8684
AT1G26550 FKBP-like peptidyl-prolyl cis-... Potri.008G089900
[exp]
8.66 0.8535
AT1G04290 Thioesterase superfamily prote... Potri.004G134066
[exp]
9.16 0.8425
AT1G01230 ORMDL family protein (.1) Potri.002G174400
[exp]
9.48 0.8793
AT5G47890 NADH-ubiquinone oxidoreductase... Potri.001G071900
[exp]
9.79 0.8868
AT1G56423 unknown protein Potri.005G017400
[exp]
11.83 0.8437
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Potri.002G016600
[exp]
11.83 0.8244 Pt-EMB1793.1
AT3G08990 Yippee family putative zinc-bi... Potri.006G015500
[exp]
12.48 0.8182
AT3G61200 Thioesterase superfamily prote... Potri.002G155500
[exp]
12.64 0.8266
AT3G19184 B3 AP2/B3-like transcriptional fa... Potri.004G141800
[exp]
13.41 0.8128

Potri.002G012700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.