Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35770 151 / 7e-47 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) AT5G66040 140 / 4e-43 STR16 sulfurtransferase protein 16 (.1.2) AT5G66170 125 / 5e-37 STR18 sulfurtransferase 18 (.1.2.3) AT2G21045 95 / 7e-25 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G17850 87 / 6e-22 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G27700 58 / 1e-10 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G42220 47 / 1e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G24750 44 / 3e-05 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT5G55130 39 / 0.0008 SIR1, CNX5 SIRTINOL RESISTANT 1, "co-factor for nitrate, reductase and xanthine dehydrogenase 5", co-factor for nitrate, reductase and xanthine dehydrogenase 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G106400 [exp] 162 / 4e-50 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.014G131300 [exp] 111 / 1e-31 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.005G111200 [exp] 108 / 2e-30 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.012G020700 [exp] 53 / 1e-08 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G008000 [exp] 53 / 2e-08 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G100600 [exp] 48 / 6e-07 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G086100 [exp] 46 / 3e-06 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.009G069300 [exp] 45 / 1e-05 AT5G19370 281 / 3e-94 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028390 [exp] 166 / 8e-53 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10041843 [exp] 165 / 4e-52 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10005635 [exp] 165 / 5e-52 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2) Lus10041525 [exp] 158 / 9e-48 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4) Lus10012566 [exp] 148 / 5e-46 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2) Lus10041895 [exp] 94 / 3e-24 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3) Lus10041894 [exp] 92 / 9e-24 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3) Lus10028442 [exp] 92 / 2e-23 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3) Lus10021227 [exp] 89 / 9e-23 AT5G66040 73 / 4e-17 sulfurtransferase protein 16 (.1.2) Lus10028441 [exp] 72 / 2e-16 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [poplar] [flax] Phosphatase PF00581 [poplar] [flax] Rhodanese Rhodanese-like domain
Representative CDS sequence Show only first row Show all	>Potri.002G014900.1 pacid=42778406 polypeptide=Potri.002G014900.1.p locus=Potri.002G014900 ID=Potri.002G014900.1.v4.1 annot-version=v4.1 ATGCCATCCTACGCTTCCCTTGCTCTCCTTGTTCGTTCCATGCGTTCTCTTTTTCGTCCTTCACAACAAGGCATTACCAGCAGGGTTTGGTGGCCAGGGT TTGCCAAAGGGCATCATCGTACGGGTGTAAGAGACAGGGTCTCCAACTTCGGATCCATTGCTGATGACAACAACGAAAATAATACAAAAACACAATCGTT TAATGTTCAGCCCAGATCAGTTCCAGTTCACGTTGCACACGAGCTTCTTCAAGTTGGACATCAGTATTTGGATGTCAGGACCCATGATGAGTTTCGTGCT GGACATCCTTCAGGGGCCATAAACATTCCTTACATGTTAAACAATGGAGCAGAAATGTTCAAGAATTCTAAATTTTTGGAGGAAGTATCATCGCAGTTCG GAAAAGATGATGATATTGTTGTTGGGTGCAAGAGTGGAAGAAGGTCGCTTATGGCAGCAAGTGATCTGCAATCAGCTGGTTTTAATCATGTAACCGATGT TGCTGGGGGATACACTGCATGGACCGAAAATGGACTCCCTATAGCAAAATAA
AA sequence Show only first row Show all	>Potri.002G014900.1 pacid=42778406 polypeptide=Potri.002G014900.1.p locus=Potri.002G014900 ID=Potri.002G014900.1.v4.1 annot-version=v4.1 MPSYASLALLVRSMRSLFRPSQQGITSRVWWPGFAKGHHRTGVRDRVSNFGSIADDNNENNTKTQSFNVQPRSVPVHVAHELLQVGHQYLDVRTHDEFRA GHPSGAINIPYMLNNGAEMFKNSKFLEEVSSQFGKDDDIVVGCKSGRRSLMAASDLQSAGFNHVTDVAGGYTAWTENGLPIAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Potri.002G014900 [exp]	0	1
AT1G32250			Calcium-binding EF-hand family...		Potri.014G030200 [exp]	3.87	0.9743
					Potri.011G102400 [exp]	4.47	0.9696
AT3G03430			Calcium-binding EF-hand family...		Potri.014G030800 [exp]	4.89	0.9696
AT3G62290		ATARFA1E	ADP-ribosylation factor A1E (....		Potri.001G301200 [exp]	4.89	0.9680
AT4G08300			nodulin MtN21 /EamA-like trans...		Potri.005G176200 [exp]	6.32	0.9715
					Potri.008G031601 [exp]	8.00	0.9500
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Potri.008G079066 [exp]	8.66	0.9689
AT4G05050		UBQ11	ubiquitin 11 (.1.2.3.4)		Potri.006G045300 [exp]	10.58	0.9666
AT3G27030			unknown protein		Potri.001G328800 [exp]	11.13	0.9267
AT5G27690			Heavy metal transport/detoxifi...		Potri.010G024700 [exp]	13.03	0.9487

Compare expression of checked genes

Potri.002G014900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.