Potri.002G017400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42200 155 / 9e-49 RING/U-box superfamily protein (.1)
AT5G05280 74 / 1e-16 RING/U-box superfamily protein (.1)
AT4G10160 74 / 2e-16 RING/U-box superfamily protein (.1)
AT3G18773 74 / 2e-16 RING/U-box superfamily protein (.1)
AT2G42350 72 / 7e-16 RING/U-box superfamily protein (.1)
AT1G49210 72 / 7e-16 RING/U-box superfamily protein (.1)
AT4G40070 73 / 1e-15 RING/U-box superfamily protein (.1)
AT5G01880 70 / 1e-15 RING/U-box superfamily protein (.1)
AT4G10150 72 / 2e-15 RING/U-box superfamily protein (.1)
AT5G66070 71 / 3e-15 RING/U-box superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G244500 240 / 4e-82 AT5G42200 149 / 3e-46 RING/U-box superfamily protein (.1)
Potri.019G057700 82 / 1e-19 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.013G091300 75 / 4e-17 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.016G136200 74 / 6e-17 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.001G162000 74 / 2e-16 AT1G53820 149 / 2e-43 RING/U-box superfamily protein (.1)
Potri.003G073300 74 / 5e-16 AT1G53820 157 / 2e-46 RING/U-box superfamily protein (.1)
Potri.013G025800 74 / 7e-16 AT3G05200 261 / 9e-84 RING/U-box superfamily protein (.1)
Potri.018G085001 74 / 9e-16 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1)
Potri.002G006400 71 / 1e-15 AT1G76410 177 / 1e-56 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017253 162 / 8e-52 AT5G42200 126 / 4e-38 RING/U-box superfamily protein (.1)
Lus10034551 144 / 4e-45 AT5G42200 112 / 2e-32 RING/U-box superfamily protein (.1)
Lus10005617 143 / 1e-44 AT5G42200 108 / 6e-31 RING/U-box superfamily protein (.1)
Lus10021842 137 / 4e-42 AT5G42200 103 / 3e-29 RING/U-box superfamily protein (.1)
Lus10015506 73 / 5e-17 AT2G18670 102 / 2e-28 RING/U-box superfamily protein (.1)
Lus10019979 73 / 2e-16 AT2G18670 113 / 5e-32 RING/U-box superfamily protein (.1)
Lus10004460 74 / 5e-16 AT3G05200 307 / 6e-102 RING/U-box superfamily protein (.1)
Lus10015901 73 / 1e-15 AT1G72220 175 / 3e-51 RING/U-box superfamily protein (.1)
Lus10009511 73 / 2e-15 AT2G20030 228 / 3e-71 RING/U-box superfamily protein (.1)
Lus10001654 72 / 2e-15 AT1G74410 251 / 1e-84 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.002G017400.1 pacid=42778519 polypeptide=Potri.002G017400.1.p locus=Potri.002G017400 ID=Potri.002G017400.1.v4.1 annot-version=v4.1
ATGGTCACACTCACACCACCTCCTATTCACTGTCCCACTCCATCACCACCCCCCTTGAGCTTTAACAGCGACGCTTCCTTCACCACCGGCCAGAACATGC
TTGTCTCTGTGCTTTTCGCACTTTTTCTGCCATGTGTAGGTATGAGCGTAGTGTTTTTTATCTATATTTGTCTCCTATGGTATGCTGCTAATAATCAACC
AGAGAACATTCCTTTACCGGTAAAAACTGTGACAGAGAAGGGTTTGTCATCATCGGAGCTCGAGAAGTTGCCTAAGGTCACCGGGAAAGAGCTTGTTTTG
GGGACAGAGTGTGCTGTTTGTCTAGATGACATTGAAAGTGAACAGCTGGCTAGGATAGTTCCTGGCTGCAATCATGGGTTTCATCTGGAATGTGCTGATA
CTTGGCTTTCCAAGCACCCTGTTTGTCCTGTTTGTCGGGCAAAGCTTGATGCTCAGTTCTCCAGTACTTCTGCTTCTCCAGAGAACAATCCTTGTTGA
AA sequence
>Potri.002G017400.1 pacid=42778519 polypeptide=Potri.002G017400.1.p locus=Potri.002G017400 ID=Potri.002G017400.1.v4.1 annot-version=v4.1
MVTLTPPPIHCPTPSPPPLSFNSDASFTTGQNMLVSVLFALFLPCVGMSVVFFIYICLLWYAANNQPENIPLPVKTVTEKGLSSSELEKLPKVTGKELVL
GTECAVCLDDIESEQLARIVPGCNHGFHLECADTWLSKHPVCPVCRAKLDAQFSSTSASPENNPC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G42200 RING/U-box superfamily protein... Potri.002G017400 0 1
AT1G07370 ATPCNA1, PCNA1 proliferating cellular nuclear... Potri.010G193950 4.00 0.9484
AT4G01440 nodulin MtN21 /EamA-like trans... Potri.002G182700 7.68 0.8967
AT5G42146 unknown protein Potri.009G129301 10.95 0.8504
AT1G79480 Carbohydrate-binding X8 domain... Potri.010G173500 11.40 0.9409
AT3G16520 UGT88A1 UDP-glucosyl transferase 88A1 ... Potri.015G027800 12.44 0.8223
Potri.016G114100 12.80 0.8183
AT1G79900 ATMBAC2, BAC2 RABIDOPSIS MITOCHONDRIAL BASIC... Potri.003G053900 13.26 0.8131
AT1G79480 Carbohydrate-binding X8 domain... Potri.006G008200 16.49 0.9396
AT3G16360 AHP4 HPT phosphotransmitter 4 (.1.2... Potri.001G189900 17.02 0.9394
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Potri.003G114400 18.00 0.9265

Potri.002G017400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.