Potri.002G017500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20225 252 / 5e-85 Thioredoxin superfamily protein (.1)
AT1G76020 225 / 2e-74 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G244400 344 / 2e-121 AT1G20225 259 / 1e-87 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005616 279 / 9e-96 AT1G20225 251 / 9e-85 Thioredoxin superfamily protein (.1)
Lus10017254 277 / 5e-95 AT1G20225 246 / 1e-82 Thioredoxin superfamily protein (.1)
Lus10021843 253 / 1e-85 AT1G20225 238 / 1e-79 Thioredoxin superfamily protein (.1)
Lus10034550 58 / 4e-11 AT1G76020 57 / 3e-11 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF13462 Thioredoxin_4 Thioredoxin
Representative CDS sequence
>Potri.002G017500.2 pacid=42779205 polypeptide=Potri.002G017500.2.p locus=Potri.002G017500 ID=Potri.002G017500.2.v4.1 annot-version=v4.1
ATGAAGAGACAGCATCACTTTGCCGTAATTCAGTTCTCTTACATATTTCTTTTCATCACCTCGTCTCAATGGAACGTCCTACCCCAGAATTTGCCACCTC
TGAGGTACGATGGGTTCGTATACGAGAATCGCAAAGGTGGCTCGGACTCCATCCTGATCGAAGCTTTCTTTGACCCTGTCTGCCCGGATTCCAGGGACAC
CTGGCCACCTCTCCAAAAAGCTCTTAAACACTACGGTTCCCGTGTTTCGCTCGTCGTTCACCTCCTCCCTTTACCCTACCACGACAACGCATTTGTAGCT
TCCCGCGCTTTGCATATTGCTAACATACTCAACTGTTCGTTTACATTCCCTTTGTTGGAGCAGTTCTTCAAGCATCAGGAGAAGTTCTATGGTTCCGAAA
CAAGCAATTTGTCAAAAGATTCCATCGTGAAGGAAATCGTGAAGTTTGCGACTGTAATTGTTGGGGATTCCTATTCTTCTCCATTGCAATTTGGTTTTAA
TGATATACAAACTGATCTGAAAACAAGGGTTTCCTTCAAGTATAGTGCTTCAAGAGGGGTATATGCCACTCCCTTTTTCTTCGTCAATGGATTTGGGTTG
CCTGGTGCCGGTTCTGCTTTGGACTATAAAGTTTGGAGAAGCATTATCGATCCGTTGGTTGGTGCAAAGTAG
AA sequence
>Potri.002G017500.2 pacid=42779205 polypeptide=Potri.002G017500.2.p locus=Potri.002G017500 ID=Potri.002G017500.2.v4.1 annot-version=v4.1
MKRQHHFAVIQFSYIFLFITSSQWNVLPQNLPPLRYDGFVYENRKGGSDSILIEAFFDPVCPDSRDTWPPLQKALKHYGSRVSLVVHLLPLPYHDNAFVA
SRALHIANILNCSFTFPLLEQFFKHQEKFYGSETSNLSKDSIVKEIVKFATVIVGDSYSSPLQFGFNDIQTDLKTRVSFKYSASRGVYATPFFFVNGFGL
PGAGSALDYKVWRSIIDPLVGAK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G20225 Thioredoxin superfamily protei... Potri.002G017500 0 1
AT1G13080 CYP71B2 "cytochrome P450, family 71, s... Potri.015G086000 1.41 0.9318
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.004G219800 2.44 0.9081
Potri.007G089400 5.29 0.8904
AT1G13260 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING ... Potri.004G219700 5.47 0.8939
AT1G58190 AtRLP9 receptor like protein 9 (.1.2) Potri.017G018700 5.47 0.8866
Potri.018G014550 6.92 0.8174
AT2G15080 AtRLP19 receptor like protein 19 (.1.2... Potri.011G104600 9.48 0.8765
AT5G34940 ATGUS3 glucuronidase 3 (.1.2.3) Potri.018G024200 13.41 0.8202
AT3G28890 AtRLP43 receptor like protein 43 (.1.2... Potri.010G009750 14.49 0.8427
AT5G48850 ATSDI1 SULPHUR DEFICIENCY-INDUCED 1, ... Potri.002G240700 18.97 0.8088

Potri.002G017500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.