Potri.002G018000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42180 484 / 1e-173 PER64 peroxidase 64, Peroxidase superfamily protein (.1)
AT5G51890 349 / 2e-120 Peroxidase superfamily protein (.1)
AT4G33420 264 / 4e-87 Peroxidase superfamily protein (.1)
AT4G37530 258 / 1e-84 Peroxidase superfamily protein (.1.2)
AT2G41480 258 / 1e-84 Peroxidase superfamily protein (.1)
AT4G37520 257 / 3e-84 Peroxidase superfamily protein (.1.2)
AT1G05260 256 / 9e-84 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT3G21770 251 / 4e-82 Peroxidase superfamily protein (.1)
AT5G14130 251 / 6e-82 Peroxidase superfamily protein (.1)
AT5G15180 250 / 1e-81 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G108900 485 / 3e-174 AT5G42180 442 / 2e-157 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.007G122200 273 / 2e-90 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
Potri.007G122351 271 / 8e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122401 271 / 8e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122250 271 / 8e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122301 271 / 8e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.018G136900 270 / 2e-89 AT4G33420 451 / 1e-160 Peroxidase superfamily protein (.1)
Potri.015G003500 270 / 2e-89 AT1G05260 291 / 1e-97 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.007G122451 269 / 6e-89 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034547 506 / 0 AT5G42180 471 / 7e-169 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10005614 475 / 3e-170 AT5G42180 461 / 6e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10017288 474 / 8e-170 AT5G42180 462 / 4e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10031664 343 / 2e-118 AT5G51890 453 / 1e-161 Peroxidase superfamily protein (.1)
Lus10027405 340 / 5e-117 AT5G51890 448 / 2e-159 Peroxidase superfamily protein (.1)
Lus10029543 265 / 2e-87 AT4G33420 479 / 1e-171 Peroxidase superfamily protein (.1)
Lus10032926 258 / 8e-85 AT1G05260 292 / 5e-98 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10001324 257 / 4e-84 AT5G17820 327 / 6e-112 Peroxidase superfamily protein (.1)
Lus10015127 256 / 7e-84 AT1G05260 444 / 7e-158 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10005679 254 / 3e-83 AT4G26010 353 / 3e-122 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.002G018000.1 pacid=42777271 polypeptide=Potri.002G018000.1.p locus=Potri.002G018000 ID=Potri.002G018000.1.v4.1 annot-version=v4.1
ATGGCGGCGGCGGCTGGTCTTGTATTTGCTCTTCTGGTCATTTTCCAAATGTCTTCCTCTGTCAGTGCCCTGAGCTCAAACTACTATGAACAGACCTGCC
CTAAGCTTGAGTCTGCTGTTACTAATGCTGTCAAGAAGGCAATGATGAATGACAAAACAGTTCCTGCTGCACTGCTTCGGATGCAGTTTCATGATTGTTT
TATTAGAGGTTGTGATGCTTCTGTACTCTTGGCATCCAAGGGTAAGAACAAAGCGGAGAAAGATGGGCCTCCTAACATTTCATTGCATGCATTTTATGTT
ATTGATAATGCAAAGAAAGCGGTGGAAGCTTTGTGCCCTGGCGTGGTTTCTTGTGCTGATATTTTGGCTCTTGCCGCAAGAGATGCAGTAGCTTTGTCTG
GAGGTCCCACTTGGGATGTGCCAAAAGGAAGAAAAGATGGAAGAATTTCGAAGGCAAGCGAAACCAGGCAATTACCAGCTCCCACCTTTAACATTTCCCA
GTTACAGCAAAGCTTCTCCCAAAGAGGTCTTTCTTTGAAGGATCTAGTAGCTCTCTCAGGAGGTCACACTCTTGGGTTCTCTCATTGTTCATCATTCCAG
AACAGAATCCACAGCTTCAATGCGACTCTCGACGTGGATCCAACTTTGAACCCATCTTTTGGAAGCAGTCTAAGGAGTGTCTGTCCTGCACACAATAAGG
TAAAAAATGCAGGTGCTACAATGGACTCTTCAACAACCACATTCGACAATGTTTACTACAAGTTGCTACTCCAGGGAAATAGTCTTTTCTCTTCAGATCA
AGCTCTACTCTCAACAAGAGAAACTAAGGCATTGGTTTCTAAATTCGCTAGCTCCCAAGAGATGTTTGAAAAAGCTTTTGTTAAGTCCATGATAAAGATG
AGTAGCATCAGTGGCGGACAAGAGATCAGGCTAGACTGTAAAGTGGTCAGATGA
AA sequence
>Potri.002G018000.1 pacid=42777271 polypeptide=Potri.002G018000.1.p locus=Potri.002G018000 ID=Potri.002G018000.1.v4.1 annot-version=v4.1
MAAAAGLVFALLVIFQMSSSVSALSSNYYEQTCPKLESAVTNAVKKAMMNDKTVPAALLRMQFHDCFIRGCDASVLLASKGKNKAEKDGPPNISLHAFYV
IDNAKKAVEALCPGVVSCADILALAARDAVALSGGPTWDVPKGRKDGRISKASETRQLPAPTFNISQLQQSFSQRGLSLKDLVALSGGHTLGFSHCSSFQ
NRIHSFNATLDVDPTLNPSFGSSLRSVCPAHNKVKNAGATMDSSTTTFDNVYYKLLLQGNSLFSSDQALLSTRETKALVSKFASSQEMFEKAFVKSMIKM
SSISGGQEIRLDCKVVR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Potri.002G018000 0 1
AT5G48485 DIR1 DEFECTIVE IN INDUCED RESISTANC... Potri.009G112553 3.74 0.7218
AT1G03220 Eukaryotic aspartyl protease f... Potri.005G095600 6.92 0.7371
AT1G64160 Disease resistance-responsive ... Potri.013G142501 8.30 0.7748
AT1G64160 Disease resistance-responsive ... Potri.001G096800 13.30 0.7623 Pt-DRR206.2
AT1G71695 Peroxidase superfamily protein... Potri.005G195600 18.33 0.6286
AT1G64160 Disease resistance-responsive ... Potri.013G142602 18.43 0.7617
AT3G19184 B3 AP2/B3-like transcriptional fa... Potri.004G141900 19.20 0.7061
AT1G64160 Disease resistance-responsive ... Potri.001G096680 21.09 0.7553
AT1G21460 SWEET1, AtSWEET... Nodulin MtN3 family protein (.... Potri.002G072800 43.58 0.6329
Potri.010G006700 43.84 0.6429

Potri.002G018000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.