Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18420 100 / 2e-28 Gibberellin-regulated family protein (.1) AT1G75750 97 / 1e-27 GASA1 GAST1 protein homolog 1 (.1.2) AT4G09600 89 / 3e-24 GASA3 GAST1 protein homolog 3 (.1) AT1G22690 85 / 2e-22 Gibberellin-regulated family protein (.1.2.3) AT4G09610 76 / 5e-19 GASA2 GAST1 protein homolog 2 (.1) AT5G14920 69 / 8e-15 Gibberellin-regulated family protein (.1.2) AT1G10588 61 / 3e-13 Gibberellin-regulated family protein (.1.2) AT2G39540 59 / 1e-12 Gibberellin-regulated family protein (.1) AT1G74670 59 / 2e-12 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G59845 58 / 3e-12 Gibberellin-regulated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G022700 [exp] 130 / 9e-41 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.005G239100 [exp] 110 / 9e-33 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.002G022600 [exp] 109 / 3e-32 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2) Potri.005G239000 [exp] 102 / 3e-29 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1) Potri.012G076700 [exp] 97 / 4e-27 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) Potri.015G071500 [exp] 93 / 1e-25 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.013G113400 [exp] 89 / 2e-24 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 80 / 2e-20 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.001G315500 [exp] 66 / 5e-15 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017212 [exp] 102 / 2e-29 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2) Lus10034524 [exp] 91 / 6e-25 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2) Lus10009421 [exp] 86 / 4e-22 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3) Lus10033145 [exp] 84 / 4e-22 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2) Lus10014262 [exp] 81 / 2e-20 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1) Lus10025962 [exp] 79 / 4e-20 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1) Lus10024338 [exp] 74 / 4e-18 ND 78 / 3e-20 Lus10021098 [exp] 69 / 4e-16 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1) Lus10039443 [exp] 69 / 2e-15 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10018016 [exp] 58 / 1e-11 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [poplar] [flax] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Potri.002G022500.1 pacid=42777014 polypeptide=Potri.002G022500.1.p locus=Potri.002G022500 ID=Potri.002G022500.1.v4.1 annot-version=v4.1 ATGCAGTCGAACAAGGAGTTCGAAACAAAACTGAAAGCTCTAGTCTCCAGTGGTGATTATACTTTAGCAATGGCTATTTCGAAGCTTTTGATCGCTTCAC TTGTCGTATCTCTTCTTGTGCTCCAGAAGGTGAACGCAAGTCCAGCTGCAGGTTCTATTCCTGGGAAAAACATTGATTGTGGCGGGGCTTGCAAAGATAG GTGTTCCTTATCCTCTAGGCCACATCTTTGCAATAGGGCTTGCGGGACATGCTGTGCACGATGCAAATGTGTCCCTAAAGGCACTTCCGGCAACCTAGAT ACTTGCCCTTGCTATGCCACCATGACTACTCATGGTGGCAGACGCAAGTGTCCTTGA
AA sequence Show only first row Show all	>Potri.002G022500.1 pacid=42777014 polypeptide=Potri.002G022500.1.p locus=Potri.002G022500 ID=Potri.002G022500.1.v4.1 annot-version=v4.1 MQSNKEFETKLKALVSSGDYTLAMAISKLLIASLVVSLLVLQKVNASPAAGSIPGKNIDCGGACKDRCSLSSRPHLCNRACGTCCARCKCVPKGTSGNLD TCPCYATMTTHGGRRKCP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18420			Gibberellin-regulated family p...		Potri.002G022500 [exp]	0	1
					Potri.001G022150 [exp]	2.44	0.7166
AT1G65840		ATPAO4	polyamine oxidase 4 (.1)		Potri.004G075800 [exp]	6.92	0.6673
AT1G68510	AS2	LBD42	LOB domain-containing protein ...		Potri.010G125000 [exp]	10.39	0.7110
AT4G05030			Copper transport protein famil...		Potri.006G001800 [exp]	10.48	0.6882
					Potri.005G226050 [exp]	13.26	0.6946
AT4G32060			calcium-binding EF hand family...		Potri.018G118008 [exp]	13.41	0.7079
AT1G08440			Aluminium activated malate tra...		Potri.009G017900 [exp]	17.66	0.6839
AT1G71450	AP2_ERF		Integrase-type DNA-binding sup...		Potri.001G181500 [exp]	18.76	0.6444
AT1G15460		ATBOR4	ARABIDOPSIS THALIANA REQUIRES ...		Potri.018G031700 [exp]	21.90	0.6491
AT3G47370			Ribosomal protein S10p/S20e fa...		Potri.002G146600 [exp]	26.51	0.5989

Compare expression of checked genes

Potri.002G022500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.