GASA1.1 (Potri.002G022600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol GASA1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75750 110 / 3e-33 GASA1 GAST1 protein homolog 1 (.1.2)
AT2G18420 108 / 3e-32 Gibberellin-regulated family protein (.1)
AT4G09600 94 / 2e-26 GASA3 GAST1 protein homolog 3 (.1)
AT1G22690 85 / 9e-23 Gibberellin-regulated family protein (.1.2.3)
AT4G09610 76 / 4e-19 GASA2 GAST1 protein homolog 2 (.1)
AT5G14920 70 / 1e-15 Gibberellin-regulated family protein (.1.2)
AT1G74670 59 / 2e-12 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT5G59845 55 / 3e-11 Gibberellin-regulated family protein (.1)
AT2G39540 55 / 4e-11 Gibberellin-regulated family protein (.1)
AT1G10588 54 / 8e-11 Gibberellin-regulated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G239100 174 / 4e-58 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022700 118 / 6e-36 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.002G022500 112 / 3e-33 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.005G239000 111 / 3e-33 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.013G113400 90 / 8e-25 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.012G076700 90 / 8e-25 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.015G071500 88 / 4e-24 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.019G083900 87 / 1e-23 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.001G350600 70 / 7e-16 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017212 109 / 1e-32 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10034524 97 / 3e-27 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10033145 87 / 2e-23 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10014262 86 / 9e-23 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10009421 86 / 2e-22 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10025962 84 / 3e-22 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10024338 83 / 4e-22 ND 78 / 3e-20
Lus10021098 73 / 5e-18 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1)
Lus10039443 67 / 7e-15 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10001407 59 / 2e-12 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.002G022600.2 pacid=42777834 polypeptide=Potri.002G022600.2.p locus=Potri.002G022600 ID=Potri.002G022600.2.v4.1 annot-version=v4.1
ATGGCTATGGCCACCAAGTTTCTGATTGCCTCACTTCTCCTCTCTCTTCTTGTTCTCCATTTTGCCGAGGCTGATCATGATCCGGTGAACTCGAATCTTG
CTGCGAGTTCTCCCCCTAAAAAAATTGATTGTGGAAGCGCTTGCAAGGCAAGGTGCCATTTATCATCGAGGCCACGCCTGTGCAAGAGAGCATGTGGGAC
TTGTTGTTCAAGATGCAGCTGTGTTCCTCCAGGAACAGCCGGTAACTATGAGGCTTGCCCCTGCTACGCCAGCTTGACTACCCATGGCGGCAGACGCAAG
TGTCCTTGA
AA sequence
>Potri.002G022600.2 pacid=42777834 polypeptide=Potri.002G022600.2.p locus=Potri.002G022600 ID=Potri.002G022600.2.v4.1 annot-version=v4.1
MAMATKFLIASLLLSLLVLHFAEADHDPVNSNLAASSPPKKIDCGSACKARCHLSSRPRLCKRACGTCCSRCSCVPPGTAGNYEACPCYASLTTHGGRRK
CP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G75750 GASA1 GAST1 protein homolog 1 (.1.2) Potri.002G022600 0 1 GASA1.1
AT5G14680 Adenine nucleotide alpha hydro... Potri.017G071700 11.74 0.7651
AT4G24900 unknown protein Potri.015G096700 18.49 0.7591
AT2G30580 BMI1A, DRIP2 DREB2A-interacting protein 2 (... Potri.013G042000 22.24 0.6939
AT4G16180 unknown protein Potri.008G104100 25.37 0.7552
AT3G18960 B3 AP2/B3-like transcriptional fa... Potri.012G093200 31.17 0.7126
AT4G39330 AtCAD1, ATCAD9 cinnamyl alcohol dehydrogenase... Potri.001G307200 32.18 0.7386 Pt-MSACAD1.1,CADL10
AT5G40660 ATP12 protein-related (.1) Potri.001G338200 40.39 0.7473
AT3G18080 BGLU44 B-S glucosidase 44 (.1) Potri.012G049300 44.89 0.6971
AT4G10030 alpha/beta-Hydrolases superfam... Potri.019G074600 46.47 0.7471
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Potri.006G036500 54.04 0.6478

Potri.002G022600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.