Potri.002G022700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75750 95 / 8e-27 GASA1 GAST1 protein homolog 1 (.1.2)
AT2G18420 92 / 6e-26 Gibberellin-regulated family protein (.1)
AT4G09600 89 / 2e-24 GASA3 GAST1 protein homolog 3 (.1)
AT1G22690 82 / 2e-21 Gibberellin-regulated family protein (.1.2.3)
AT4G09610 69 / 1e-16 GASA2 GAST1 protein homolog 2 (.1)
AT5G14920 67 / 2e-14 Gibberellin-regulated family protein (.1.2)
AT1G74670 59 / 2e-12 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT2G39540 58 / 2e-12 Gibberellin-regulated family protein (.1)
AT5G59845 57 / 8e-12 Gibberellin-regulated family protein (.1)
AT1G10588 56 / 1e-11 Gibberellin-regulated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G022500 130 / 7e-41 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.005G239100 115 / 7e-35 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022600 112 / 2e-33 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.005G239000 94 / 3e-26 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.013G113400 84 / 8e-23 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.012G076700 84 / 2e-22 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.015G071500 82 / 1e-21 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.019G083900 72 / 1e-17 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.001G350600 66 / 3e-14 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017212 96 / 2e-27 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10034524 86 / 3e-23 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10014262 86 / 1e-22 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10025962 85 / 2e-22 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10033145 81 / 3e-21 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10009421 74 / 1e-17 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10024338 71 / 3e-17 ND 78 / 3e-20
Lus10021098 64 / 8e-15 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1)
Lus10039443 63 / 1e-13 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10018016 59 / 2e-12 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.002G022700.1 pacid=42777024 polypeptide=Potri.002G022700.1.p locus=Potri.002G022700 ID=Potri.002G022700.1.v4.1 annot-version=v4.1
ATGGCTATTTCAAAGCTTTTGATTGCTTCCCTGCTCGTATCTCTTCTTGTGCTCCATCTTGCCGAAGCTGATCAGAAGGTGAACTCAAATCAAGCTGCAA
GCCATGTTCCTGGAAACAATATCGACTGTGGTGGCGCTTGCCATGCTAGGTGTTCGTTGTCCTCTAGGCCTCGTCTTTGCAAGAGGGCTTGCGGGTCATG
CTGTGCCCGATGCAAATGTGTCCCTCAAGGCACTTCCGGCAACCTGGATACCTGCCCTTGCTATGCCACCTTGACTACTCGTGGAGGCAGACGCAAGTGT
CCTTGA
AA sequence
>Potri.002G022700.1 pacid=42777024 polypeptide=Potri.002G022700.1.p locus=Potri.002G022700 ID=Potri.002G022700.1.v4.1 annot-version=v4.1
MAISKLLIASLLVSLLVLHLAEADQKVNSNQAASHVPGNNIDCGGACHARCSLSSRPRLCKRACGSCCARCKCVPQGTSGNLDTCPCYATLTTRGGRRKC
P

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G75750 GASA1 GAST1 protein homolog 1 (.1.2) Potri.002G022700 0 1
AT2G41480 Peroxidase superfamily protein... Potri.016G125000 9.38 0.7136
AT1G44970 Peroxidase superfamily protein... Potri.002G031200 24.33 0.7091
AT1G25560 AP2_ERF EDF1, TEM1 TEMPRANILLO 1, ETHYLENE RESPON... Potri.008G117100 24.49 0.6314 Pt-RAV2.1
AT5G64260 EXL2, MSJ1.10 EXORDIUM like 2 (.1) Potri.001G311700 25.29 0.6636 MSJ1.1
AT4G39330 AtCAD1, ATCAD9 cinnamyl alcohol dehydrogenase... Potri.009G062901 29.59 0.7087
AT3G14470 NB-ARC domain-containing disea... Potri.012G123200 30.28 0.6539
AT3G14470 NB-ARC domain-containing disea... Potri.014G003832 34.23 0.6645
AT2G18420 Gibberellin-regulated family p... Potri.002G022500 37.94 0.5958
AT4G27220 NB-ARC domain-containing disea... Potri.018G145562 48.90 0.6335
AT2G47270 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA... Potri.014G118300 53.83 0.6158

Potri.002G022700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.