Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1) AT4G35410 162 / 5e-52 Clathrin adaptor complex small chain family protein (.1.2) AT2G17380 161 / 9e-52 AP19 associated protein 19 (.1) AT2G19790 126 / 4e-38 SNARE-like superfamily protein (.1) AT3G50860 113 / 9e-33 Clathrin adaptor complex small chain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G238701 [exp] 283 / 5e-100 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1) Potri.012G052000 [exp] 160 / 3e-51 AT2G17380 307 / 6e-109 associated protein 19 (.1) Potri.014G079000 [exp] 159 / 5e-51 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2) Potri.002G001800 [exp] 157 / 7e-50 AT2G17380 278 / 3e-97 associated protein 19 (.1) Potri.006G149100 [exp] 127 / 3e-38 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1) Potri.007G025400 [exp] 105 / 2e-29 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1) Potri.005G122900 [exp] 103 / 1e-28 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024337 [exp] 282 / 1e-98 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1) Lus10026316 [exp] 167 / 1e-53 AT2G17380 297 / 7e-105 associated protein 19 (.1) Lus10042352 [exp] 167 / 2e-53 AT2G17380 297 / 3e-104 associated protein 19 (.1) Lus10003641 [exp] 131 / 1e-39 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2) Lus10012924 [exp] 127 / 3e-38 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1) Lus10035004 [exp] 116 / 3e-34 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1) Lus10041742 [exp] 94 / 7e-25 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1) Lus10024011 [exp] 88 / 2e-22 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF01217 [poplar] [flax] Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence Show only first row Show all	>Potri.002G022900.2 pacid=42779692 polypeptide=Potri.002G022900.2.p locus=Potri.002G022900 ID=Potri.002G022900.2.v4.1 annot-version=v4.1 ATGATCCGATTTATACTCCTGCAAAACAGACAAGGCAAGACTCGTCTCGCTAAATACTATGTTCCTCTTGAGGATTCCGAGAAGCACAAAGTCGAATACG AGGTTCACCGATTGGTTGTTAATAGAGATGCTAAATTCACGAATTTTGTTGAGTTTAGGACACACAAGGTGATATACAGGCGGTATGCTGGATTGTTTTT TTCGCTGTGTGTCGACATAACGGATAACGAATTGGCTTATTTGGAGTGCATTCATTTATTTGTGGAGATATTGGATCATTTCTTCAGCAATGTGTGTGAG CTAGATTTGGTGTTTAACTTTCACAAGGTTTATTTGATACTTGATGAATTCATTCTCGCTGGGGAGCTTCAAGAAACAAGCAAGAGGGCAATCATAGAGA GAATGGGAGAGCTGGAGAAGCTGGAGTAA
AA sequence Show only first row Show all	>Potri.002G022900.2 pacid=42779692 polypeptide=Potri.002G022900.2.p locus=Potri.002G022900 ID=Potri.002G022900.2.v4.1 annot-version=v4.1 MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDAKFTNFVEFRTHKVIYRRYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCE LDLVFNFHKVYLILDEFILAGELQETSKRAIIERMGELEKLE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47830			SNARE-like superfamily protein...		Potri.002G022900 [exp]	0	1
AT2G28760		UXS6	UDP-XYL synthase 6 (.1.2.3)		Potri.010G207200 [exp]	4.47	0.9501	UXS1.1
AT4G15830			ARM repeat superfamily protein...		Potri.010G014200 [exp]	4.89	0.9485
AT1G51160			SNARE-like superfamily protein...		Potri.017G149900 [exp]	5.47	0.9409
AT3G23610		DSPTP1	dual specificity protein phosp...		Potri.010G033000 [exp]	6.00	0.9396
AT2G30050			transducin family protein / WD...		Potri.008G141300 [exp]	6.24	0.9458
AT2G17380		AP19	associated protein 19 (.1)		Potri.012G052000 [exp]	7.61	0.9221	AP19.2
AT3G07950			rhomboid protein-related (.1)		Potri.010G220900 [exp]	9.38	0.9380
AT5G05800			unknown protein		Potri.008G196901 [exp]	9.89	0.9345
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.008G100000 [exp]	10.19	0.9418	ARF1.3
AT5G52210		ATGB1, ATARLB1	GTP-binding protein 1 (.1.2)		Potri.012G138500 [exp]	11.66	0.9207

Compare expression of checked genes

Potri.002G022900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.