Potri.002G023600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75690 194 / 3e-64 LQY1 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
AT2G34860 41 / 0.0001 EDA3 embryo sac development arrest 3, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1.2)
AT2G24860 40 / 0.0001 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G237800 234 / 4e-80 AT1G75690 182 / 8e-60 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.006G266800 39 / 0.0003 AT2G24860 167 / 3e-54 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.018G016400 39 / 0.0004 AT2G24860 165 / 5e-53 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.001G009800 39 / 0.0005 AT2G34860 201 / 6e-66 embryo sac development arrest 3, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002040 181 / 6e-59 AT1G75690 203 / 5e-68 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10024330 143 / 3e-44 AT1G75690 164 / 1e-52 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10026899 38 / 0.0008 AT2G24860 154 / 6e-49 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.002G023600.2 pacid=42777970 polypeptide=Potri.002G023600.2.p locus=Potri.002G023600 ID=Potri.002G023600.2.v4.1 annot-version=v4.1
ATGCCAGTAGCGCCTTCCATCCCTCGTCTTCACTCACCATTTCTATGCTGCCCTCTTAACAATATCTCTTCTTCACTGTCATCCTTCAAGTCCGCGAGAC
ATCATCCTCAACGGTCACCAGTGTCTTATCCATGCATCAGAGCTATTGATCTTGATCAGAACACGATAGTGGCAATTTCGGTCGGGGTCGTGAGCATTGC
TGCTGGGATAGGAATTCCTGTTTTCTACGAATCCCAGATTGATAATGCTGCAAAGCGAGACAATACCCAGCCATGTTTCCCTTGCAGTGGCAGCGGTGCA
CAAAAATGTAGATTTTGCCTGGGAACTGGCTCAGTGACAGTGGAGCTAGGTGGGGATGAAAAAGAAGTCTCTAGATGCATCAATTGCGACGGTATCGGTT
CTTTGACTTGCACAACATGTCAAGGCAGTGGCATTCAACCCCGGTATCTAGATCGCAGAGAATTCAAGGATGATGATTGA
AA sequence
>Potri.002G023600.2 pacid=42777970 polypeptide=Potri.002G023600.2.p locus=Potri.002G023600 ID=Potri.002G023600.2.v4.1 annot-version=v4.1
MPVAPSIPRLHSPFLCCPLNNISSSLSSFKSARHHPQRSPVSYPCIRAIDLDQNTIVAISVGVVSIAAGIGIPVFYESQIDNAAKRDNTQPCFPCSGSGA
QKCRFCLGTGSVTVELGGDEKEVSRCINCDGIGSLTCTTCQGSGIQPRYLDRREFKDDD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G75690 LQY1 LOW QUANTUM YIELD OF PHOTOSYST... Potri.002G023600 0 1
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Potri.001G450100 2.44 0.9697
AT1G58290 AtHEMA1, HEMA1 Arabidopsis thaliana hemA 1, G... Potri.002G107800 2.44 0.9773
AT2G05070 LHCB2.2 LIGHT-HARVESTING CHLOROPHYLL B... Potri.002G221400 2.82 0.9722 2,Pt-LHCB2.1
AT5G54270 LHCB3*1, LHCB3*... light-harvesting chlorophyll B... Potri.001G407100 3.74 0.9762 Lhcb3-1,LHCB3.2
AT1G15820 CP24, LHCB6 light harvesting complex photo... Potri.003G020400 4.89 0.9728
AT2G06510 ATRPA70A, ATRPA... ARABIDOPSIS THALIANA RPA70-KDA... Potri.018G065300 8.36 0.9715
AT2G21280 GC1, ATSULA GIANT CHLOROPLAST 1, NAD(P)-bi... Potri.009G124800 9.38 0.9654 GC1.1
AT3G63410 VTE3, APG1, IEP... VITAMIN E DEFECTIVE 3, INNER E... Potri.008G159400 9.94 0.9652 Pt-APG1.1
AT3G15520 Cyclophilin-like peptidyl-prol... Potri.001G404700 11.31 0.9631
AT3G47430 PEX11B peroxin 11B (.1) Potri.001G124400 12.00 0.9642

Potri.002G023600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.