Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75590 194 / 8e-65 SAUR-like auxin-responsive protein family (.1) AT1G19840 192 / 5e-64 SAUR-like auxin-responsive protein family (.1) AT5G10990 185 / 4e-61 SAUR-like auxin-responsive protein family (.1) AT4G34750 142 / 4e-44 SAUR-like auxin-responsive protein family (.1.2) AT5G20810 84 / 4e-21 SAUR-like auxin-responsive protein family (.1.2) AT2G21220 81 / 1e-20 SAUR-like auxin-responsive protein family (.1) AT4G34760 81 / 1e-20 SAUR-like auxin-responsive protein family (.1) AT3G43120 80 / 1e-19 SAUR-like auxin-responsive protein family (.1) AT2G24400 79 / 8e-19 SAUR-like auxin-responsive protein family (.1) AT5G66260 76 / 9e-19 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G237000 [exp] 287 / 2e-101 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 188 / 3e-62 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 184 / 1e-60 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.008G037900 [exp] 85 / 6e-22 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 85 / 7e-22 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.018G063400 [exp] 84 / 5e-21 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2) Potri.006G278100 [exp] 83 / 2e-20 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.006G126500 [exp] 81 / 3e-20 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1) Potri.016G091500 [exp] 80 / 5e-20 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034507 [exp] 214 / 2e-72 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 209 / 1e-70 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10012426 [exp] 209 / 3e-70 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10024322 [exp] 174 / 8e-57 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 133 / 1e-40 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2) Lus10026297 [exp] 129 / 1e-38 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 126 / 8e-38 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10021130 [exp] 92 / 1e-24 AT4G34750 97 / 8e-27 SAUR-like auxin-responsive protein family (.1.2) Lus10017179 [exp] 84 / 9e-22 AT4G34750 89 / 6e-24 SAUR-like auxin-responsive protein family (.1.2) Lus10041921 [exp] 78 / 4e-19 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.002G024500.1 pacid=42777538 polypeptide=Potri.002G024500.1.p locus=Potri.002G024500 ID=Potri.002G024500.1.v4.1 annot-version=v4.1 ATGTCAGCTGGGCTAGCAAAATGCGCCAAAATCCGCCACATAGTGAGGCTTCGTCAAATGCTAAGGCGTTGGCGCAACAAGGCACGAATGTCAGCCAATC GCATACCATCGGATGTTCCAGCAGGACACGTAGCGGTCTGTGTAGGGACTGGTTGCAGGAGATTTGTGGTTCGCGCGACGTACCTGAACCACCCCATCTT TAAAAAGCTCCTAGTGCAAGCCGAAGAAGAGTTTGGGTTCTCTAACCAAGGCCCATTAACGATCCCATGCGATGAGACCCTTTTTGAGGAAATGATTCGG TGCATTTCACGGTCGGAGAATGGAAAATCAGACCTGTTTGTGAATCTTGAGGATTTGCAGAGATACTGCCACGTTGGTGTTAAAAATGCTAAGCTTGATT TTTGGACCGATTCAAGACCCCTGCTTCATTCTGATAACTCATTCTGGTGA
AA sequence Show only first row Show all	>Potri.002G024500.1 pacid=42777538 polypeptide=Potri.002G024500.1.p locus=Potri.002G024500 ID=Potri.002G024500.1.v4.1 annot-version=v4.1 MSAGLAKCAKIRHIVRLRQMLRRWRNKARMSANRIPSDVPAGHVAVCVGTGCRRFVVRATYLNHPIFKKLLVQAEEEFGFSNQGPLTIPCDETLFEEMIR CISRSENGKSDLFVNLEDLQRYCHVGVKNAKLDFWTDSRPLLHSDNSFW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75590			SAUR-like auxin-responsive pro...		Potri.002G024500 [exp]	0	1
AT5G23750			Remorin family protein (.1.2)		Potri.001G107000 [exp]	3.16	0.9129
AT2G27740			Family of unknown function (DU...		Potri.009G147500 [exp]	4.24	0.8859
AT3G03210			unknown protein		Potri.017G139800 [exp]	7.34	0.9078
AT4G30600			signal recognition particle re...		Potri.006G183600 [exp]	8.00	0.8808
AT1G18190		GC2	golgin candidate 2 (.1)		Potri.015G039800 [exp]	10.67	0.8585
AT5G67210		IRX15-L	IRX15-LIKE, Protein of unknown...		Potri.007G047000 [exp]	11.09	0.9042
AT5G03110			unknown protein		Potri.016G086900 [exp]	12.68	0.8832
					Potri.002G226400 [exp]	13.63	0.8511
AT1G19870		IQD32	IQ-domain 32 (.1)		Potri.005G236200 [exp]	13.71	0.8985
AT5G12250		TUB6	beta-6 tubulin (.1)		Potri.001G104600 [exp]	13.78	0.8863

Compare expression of checked genes

Potri.002G024500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.