Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19880 44 / 2e-05 Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G026600 [exp] 127 / 7e-35 AT1G19880 703 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.005G236000 [exp] 91 / 4e-22 AT1G19880 674 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033168 [exp] 57 / 7e-10 AT1G19880 724 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G025600.1 pacid=42778816 polypeptide=Potri.002G025600.1.p locus=Potri.002G025600 ID=Potri.002G025600.1.v4.1 annot-version=v4.1 ATGGGCCATTCCATGGTCATAGTTGACAGAATGAATGTTGGTCATCGACTTGATCAGCTTGATGTCTATGATGGCAAAGCTTCTGGTGAAGGCAGTGGGG AGCCTGAGCGTAAAAACCTTGTGAAGCAAAGTGCGAAAAAGGGTGCCGCCAGAGCTTCTGATAACTCCAGAAAGAGGAAGTCAAAAGATTCATCGAAATC TGAAGATGAAGAGAATGGTGATGACGAAAGTGATGCTAGTGAAGATCAAGTCAATGGCCAGACAGAAAAGAAGAGCAAACGGGGTGGAAAAGTTTCTGGC AGGGGTCAAAGTAAAGGTGGAAAAAAATCAACATCCGATGGAAAAAGTACAGGGCGTGGGCGGGGCCGCCCTCTATCAGGAAATAAAAGCACAGTTTCGT CTCAAGAAAAAGCTGGTAAGAGAGGAAGACCACGCAAGTCGTGA
AA sequence Show only first row Show all	>Potri.002G025600.1 pacid=42778816 polypeptide=Potri.002G025600.1.p locus=Potri.002G025600 ID=Potri.002G025600.1.v4.1 annot-version=v4.1 MGHSMVIVDRMNVGHRLDQLDVYDGKASGEGSGEPERKNLVKQSAKKGAARASDNSRKRKSKDSSKSEDEENGDDESDASEDQVNGQTEKKSKRGGKVSG RGQSKGGKKSTSDGKSTGRGRGRPLSGNKSTVSSQEKAGKRGRPRKS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G19880			Regulator of chromosome conden...		Potri.002G025600 [exp]	0	1
AT3G49430		SRP34A, SR34a, ...	Serine/Arginine-Rich Protein S...		Potri.012G021800 [exp]	1.73	0.8050
AT3G07930			DNA glycosylase superfamily pr...		Potri.014G187000 [exp]	3.46	0.8098
AT3G59890			Dihydrodipicolinate reductase,...		Potri.017G001900 [exp]	6.32	0.7649
					Potri.009G065201 [exp]	6.92	0.7788
AT3G11730		ATFP8, AtRABD1	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.003G004000 [exp]	8.48	0.7624
AT2G34260		WDR55	human WDR55 \(WD40 repeat\) ho...		Potri.004G095000 [exp]	9.16	0.7541
AT1G80410		OMA, EMB2753	OMISHA, EMBRYO DEFECTIVE 2753,...		Potri.001G177700 [exp]	11.74	0.8094
AT3G07930			DNA glycosylase superfamily pr...		Potri.014G187300 [exp]	20.97	0.7392
AT3G42860			zinc knuckle (CCHC-type) famil...		Potri.001G318100 [exp]	23.97	0.7816
AT4G38640			Plasma-membrane choline transp...		Potri.004G173600 [exp]	24.24	0.7133

Compare expression of checked genes

Potri.002G025600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.