AVA.1 (Potri.002G027200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol AVA.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G19910 226 / 9e-77 AVA-2PE, ATVHA-C2, AVA-P2 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
AT4G34720 223 / 2e-75 ATVHA-C1, AVA-P1 VACUOLAR H+-PUMPING ATPASE C1, ATPase, F0/V0 complex, subunit C protein (.1)
AT4G38920 223 / 2e-75 AVA-P3, ATVHA-C3 vacuolar-type H\(+\)-ATPase C3, vacuolar-type H\(+\)-ATPase C3, vacuolar-type H(+)-ATPase C3 (.1)
AT2G16510 223 / 2e-75 AVA-P1 ATPase, F0/V0 complex, subunit C protein (.1)
AT1G75630 219 / 3e-74 AVA-P4, AVA-P vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4, vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 (.1), vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 (.2)
AT2G25610 55 / 8e-10 ATPase, F0/V0 complex, subunit C protein (.1)
AT4G32530 55 / 9e-10 ATPase, F0/V0 complex, subunit C protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G082700 224 / 3e-76 AT1G19910 221 / 9e-75 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Potri.005G235300 224 / 3e-76 AT1G19910 225 / 2e-76 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Potri.007G014600 224 / 6e-76 AT1G19910 224 / 5e-76 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Potri.004G163400 223 / 2e-75 AT4G34720 224 / 4e-76 VACUOLAR H+-PUMPING ATPASE C1, ATPase, F0/V0 complex, subunit C protein (.1)
Potri.009G125000 222 / 2e-74 AT4G34720 226 / 4e-76 VACUOLAR H+-PUMPING ATPASE C1, ATPase, F0/V0 complex, subunit C protein (.1)
Potri.006G248700 54 / 2e-09 AT4G32530 281 / 3e-98 ATPase, F0/V0 complex, subunit C protein (.1.2)
Potri.018G032600 53 / 3e-09 AT2G25610 249 / 8e-86 ATPase, F0/V0 complex, subunit C protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033179 224 / 4e-76 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Lus10028367 224 / 4e-76 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Lus10028370 224 / 4e-76 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Lus10041819 224 / 4e-76 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Lus10010618 224 / 4e-76 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Lus10010619 223 / 1e-75 AT1G19910 315 / 5e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Lus10010623 223 / 2e-75 AT1G19910 315 / 6e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1)
Lus10000347 54 / 4e-09 AT4G32530 312 / 3e-110 ATPase, F0/V0 complex, subunit C protein (.1.2)
Lus10000694 54 / 4e-09 AT4G32530 312 / 3e-110 ATPase, F0/V0 complex, subunit C protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00137 ATP-synt_C ATP synthase subunit C
Representative CDS sequence
>Potri.002G027200.4 pacid=42780158 polypeptide=Potri.002G027200.4.p locus=Potri.002G027200 ID=Potri.002G027200.4.v4.1 annot-version=v4.1
ATGGCTTCGACATTCAGTGGCGATGAAACCGCTCCGTTCTTCGGATTCCTCGGCGCCGCTGCCGCCCTTGTTTTCTCCTGCATGGGAGCTGCGTACGGTA
CCGCGAAGAGTGGAGTTGGCGTTGCATCGATGGGTGTGATGCGACCAGAACTCGTGATGAAATCCATAGTTCCGGTTGTTATGGCTGGAGTTTTGGGTAT
ATACGGTCTGATCATTGCTGTGATTATCAGTACCGGTATTAACCCTAAAGCAAAATCCTATTATCTTTTTGATGGATATGCTCATCTCTCTTCTGGCCTT
GCTTGTGGCCTCGCTGGTCTCTCTGCTGGTATGGCTATTGGCATCGTTGGTGATGCTGGTGTTAGAGCTAATGCCCAGCAGCCAAAGCTTTTTGTTGGGA
TGATCCTCATTCTCATCTTTGCTGAAGCACTTGCCCTCTACGGTCTCATTGTTGGTATCATTCTTTCCTCCCGAGCTGGTCAATCGAGAGCTGAGTAA
AA sequence
>Potri.002G027200.4 pacid=42780158 polypeptide=Potri.002G027200.4.p locus=Potri.002G027200 ID=Potri.002G027200.4.v4.1 annot-version=v4.1
MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGL
ACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G19910 AVA-2PE, ATVHA-... VACUOLAR-TYPE H+ ATPASE C2, AT... Potri.002G027200 0 1 AVA.1
AT1G49140 Complex I subunit NDUFS6 (.1) Potri.015G054700 6.70 0.8464
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Potri.001G369000 7.21 0.8767
AT1G72020 unknown protein Potri.019G081700 10.77 0.8739
AT5G61310 Cytochrome c oxidase subunit V... Potri.002G195901 10.81 0.8687
AT2G20930 SNARE-like superfamily protein... Potri.009G136800 12.00 0.8345
AT5G24400 PGL3, EMB2024 6-PHOSPHOGLUCONOLACTONASE 3, E... Potri.015G007200 14.69 0.7629
AT5G65270 AtRABA4a RAB GTPase homolog A4A (.1) Potri.005G073000 16.15 0.7955 Pt-ATGB3.3
AT1G67785 unknown protein Potri.015G087301 19.74 0.8489
AT5G13050 5-FCL 5-formyltetrahydrofolate cyclo... Potri.012G072800 20.49 0.7974
AT1G09150 pseudouridine synthase and arc... Potri.005G023600 28.63 0.8549

Potri.002G027200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.