Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	VFCYSPRO.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39090 537 / 0 EMB3005, RD19A, RD19 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) AT4G16190 533 / 0 Papain family cysteine protease (.1) AT2G21430 521 / 0 Papain family cysteine protease (.1) AT3G54940 409 / 1e-142 Papain family cysteine protease (.2) AT3G19400 219 / 2e-68 Cysteine proteinases superfamily protein (.1.2) AT3G19390 210 / 5e-64 Granulin repeat cysteine protease family protein (.1) AT1G20850 206 / 3e-63 XCP2 xylem cysteine peptidase 2 (.1) AT5G43060 206 / 3e-62 Granulin repeat cysteine protease family protein (.1) AT1G09850 203 / 2e-61 XBCP3 xylem bark cysteine peptidase 3 (.1) AT4G35350 199 / 2e-60 XCP1 xylem cysteine peptidase 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G234000 [exp] 615 / 0 AT4G39090 501 / 9e-179 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Potri.004G160300 [exp] 560 / 0 AT4G39090 549 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Potri.009G121300 [exp] 542 / 0 AT4G39090 571 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Potri.010G228400 [exp] 378 / 3e-130 AT3G54940 501 / 6e-179 Papain family cysteine protease (.2) Potri.007G047600 [exp] 209 / 3e-64 AT5G43060 461 / 9e-162 Granulin repeat cysteine protease family protein (.1) Potri.004G207600 [exp] 206 / 2e-63 AT4G35350 543 / 0.0 xylem cysteine peptidase 1 (.1.2) Potri.005G141600 [exp] 200 / 1e-60 AT4G36880 437 / 1e-153 cysteine proteinase1 (.1) Potri.014G024100 [exp] 200 / 5e-60 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1) Potri.009G098100 [exp] 199 / 3e-59 AT1G47128 607 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024303 [exp] 544 / 0 AT4G39090 520 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10028797 [exp] 520 / 0 AT4G39090 559 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10017487 [exp] 510 / 0 AT4G39090 550 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10002103 [exp] 443 / 2e-157 AT4G39090 431 / 5e-153 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10038684 [exp] 377 / 2e-129 AT3G54940 499 / 1e-177 Papain family cysteine protease (.2) Lus10037951 [exp] 345 / 3e-115 AT3G54940 451 / 6e-157 Papain family cysteine protease (.2) Lus10017489 [exp] 275 / 4e-92 AT4G39090 314 / 5e-108 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10013204 [exp] 206 / 3e-63 AT1G20850 509 / 0.0 xylem cysteine peptidase 2 (.1) Lus10015285 [exp] 201 / 6e-62 AT5G45890 406 / 8e-143 senescence-associated gene 12 (.1) Lus10030722 [exp] 202 / 8e-62 AT4G35350 511 / 0.0 xylem cysteine peptidase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF00112 [poplar] [flax] Peptidase_C1 Papain family cysteine protease CL0125 [poplar] [flax] PF08246 [poplar] [flax] Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Representative CDS sequence Show only first row Show all	>Potri.002G028700.2 pacid=42779663 polypeptide=Potri.002G028700.2.p locus=Potri.002G028700 ID=Potri.002G028700.2.v4.1 annot-version=v4.1 ATGGAGCGCTTTTCTCTGCTCGCACTCCTCCTTCTTACACTCATATGCTCCGCAGTTGCATCCACAGTATCTTCCAACGACCTAGACGATCCTTTAATCA GACAAGTCGTATCAGACGGCGAGGATGATCTCCTCAACGCAGAGCATCATTTCACTTCTTTCAAATCCAAATTCGGCAAAACATACGCGACTCAAGAAGA GCATGATTACCGATTTGGTGTTTTCAAAGCTAATCTTCGCCGTGCGAAGAAACACCAGATGATAGACCCCACCGCCGCCCACGGCATCACCAAGTTCTCT GACCTGACACCGAAAGAATTCCGCCGCCAGTTCCTTGGATTGAAGCGGTGGCTACGGTTGCCTACGGACGCTAACAAGGCGCCGATTCTTCCTACTACTG ATCTACCTACTGATTATGACTGGCGCGATCACGGTGCCGTTACAGAAGTCAAAGACCAGGGATCGTGTGGATCGTGCTGGTCGTTTAGTGCTACCGGGGC GTTAGAAGGAGCTCATTATTTAGCCACAGGAGAGCTTGCGAGCCTGAGTGAGCAGCAGCTTGTGGACTGCGATCATGAGTGTGATCCAGAAGAATATGGC GCTTGTGACTCTGGCTGCGATGGTGGGCTGATGAATAATGCCTTCGAGTACGCACTCAAGGCTGGTGGACTTGAACGTGAGGAAGACTATCCTTACACTG GAACTGACGGTGGCACTTGCAAATTTGACAAGAGCAAAGTTGTAGCATCCGTATCTAACTTCAGTGTTGTTTCAATCGATGAAGATCAAATTGCTGCGAA TCTGGTGAAGCATGGTCCACTCTCAGTGGCGATCAATGCAGCTTTTATGCAGACATATGTAGGTGGAGTTTCATGCCCATACATTTGCTCGAAGCGTCAG GATCACGGGGTGCTACTGGTGGGGTATGGATCCGCTGGTTATGCTCCTATCCGGTTTAAGGAAAAGCCCTTCTGGATTATCAAGAATTCATGGGGACAGA ATTGGGGAGAGAATGGCTATTACAAAATCTGCAGGGGTCGCAATATCTGTGGTGTAGATTCCATGGTTTCAACTGTTGCTGCAATTCACACTACAGCTCA GTAG
AA sequence Show only first row Show all	>Potri.002G028700.2 pacid=42779663 polypeptide=Potri.002G028700.2.p locus=Potri.002G028700 ID=Potri.002G028700.2.v4.1 annot-version=v4.1 MERFSLLALLLLTLICSAVASTVSSNDLDDPLIRQVVSDGEDDLLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQMIDPTAAHGITKFS DLTPKEFRRQFLGLKRWLRLPTDANKAPILPTTDLPTDYDWRDHGAVTEVKDQGSCGSCWSFSATGALEGAHYLATGELASLSEQQLVDCDHECDPEEYG ACDSGCDGGLMNNAFEYALKAGGLEREEDYPYTGTDGGTCKFDKSKVVASVSNFSVVSIDEDQIAANLVKHGPLSVAINAAFMQTYVGGVSCPYICSKRQ DHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHTTAQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Potri.002G028700 [exp]	0	1	VFCYSPRO.1
AT1G35620		ATPDI8, ATPDIL5...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.019G082400 [exp]	3.46	0.9350
AT1G13680			PLC-like phosphodiesterases su...		Potri.011G144900 [exp]	3.60	0.9547
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.005G079600 [exp]	4.58	0.9436	Pt-ACT11.10
AT3G13540	MYB	ATMYB5, ATM2	myb domain protein 5 (.1)		Potri.013G056500 [exp]	5.29	0.9449
AT3G09520		ATEXO70H4	exocyst subunit exo70 family p...		Potri.006G214300 [exp]	6.00	0.9178
AT5G16370		AAE5	acyl activating enzyme 5 (.1)		Potri.019G067800 [exp]	7.41	0.9433
AT5G36930			Disease resistance protein (TI...		Potri.013G098100 [exp]	7.48	0.9378
AT3G45310			Cysteine proteinases superfami...		Potri.006G141700 [exp]	7.74	0.9405	Pt-ELSA.1
AT1G12550		HPR3	hydroxypyruvate reductase 3, D...		Potri.001G113250 [exp]	8.60	0.9178
AT5G38260			Protein kinase superfamily pro...		Potri.007G125450 [exp]	8.71	0.9436

Compare expression of checked genes

Potri.002G028700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.