Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42990 251 / 9e-87 UBC18 ubiquitin-conjugating enzyme 18 (.1) AT1G45050 249 / 7e-86 ATUBC2-1, UBC15 Arabidopsis thaliana ubiquitin-conjugating enzyme 15, Ubiquitin-conjugating enzyme family protein (.1) AT1G75440 248 / 1e-85 UBC16 ubiquitin-conjugating enzyme 16 (.1) AT4G36410 233 / 1e-79 UBC17 ubiquitin-conjugating enzyme 17 (.1) AT5G41700 74 / 2e-17 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT2G16740 73 / 6e-17 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 73 / 7e-17 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT5G53300 72 / 7e-17 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT4G27960 71 / 4e-16 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G64230 71 / 7e-16 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G232100 [exp] 275 / 2e-96 AT5G42990 256 / 1e-88 ubiquitin-conjugating enzyme 18 (.1) Potri.005G118600 [exp] 259 / 5e-90 AT1G75440 296 / 1e-104 ubiquitin-conjugating enzyme 16 (.1) Potri.007G018700 [exp] 254 / 4e-88 AT1G75440 295 / 3e-104 ubiquitin-conjugating enzyme 16 (.1) Potri.001G471200 [exp] 74 / 2e-17 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 74 / 5e-17 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.003G136200 [exp] 74 / 5e-17 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.016G138900 [exp] 74 / 5e-17 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G131400 [exp] 74 / 5e-17 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.011G168200 [exp] 73 / 8e-17 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028341 [exp] 231 / 4e-79 AT1G75440 250 / 8e-87 ubiquitin-conjugating enzyme 16 (.1) Lus10041791 [exp] 216 / 7e-73 AT1G75440 246 / 9e-85 ubiquitin-conjugating enzyme 16 (.1) Lus10014187 [exp] 72 / 3e-16 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10021385 [exp] 72 / 3e-16 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 72 / 3e-16 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027846 [exp] 72 / 3e-16 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10033937 [exp] 72 / 3e-16 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10032352 [exp] 72 / 3e-16 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10028700 [exp] 71 / 6e-16 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10009422 [exp] 71 / 6e-16 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.002G030800.1 pacid=42776753 polypeptide=Potri.002G030800.1.p locus=Potri.002G030800 ID=Potri.002G030800.1.v4.1 annot-version=v4.1 ATGACAAGCAGCTCCGCTTCGTCACGCAAGGCTTTAAGCAAGATCGCTTGCAACAGACTGCAAAAGGAGCTTACAGAATGGCAACTCAGTCCTCCTTCAA GTTTCAAGCATAAAGTCACCGATAATCTCCAACGATGGGTGATTGAAGCGAATGGAGCCGCAGGCACTCTTTATGCAAATGAAACTTATCAGCTTCAAGT CGATTTCCCTGAACATTACCCTATGGAAGCACCTCAGGTGATTTTCGCCCCGCCGGCTCCTCTGCATCCTCACATCTATAGCAACGGACATATCTGTTTA GATATACTGTATGATTCATGGTCCCCAGCTATGACTGTTAGTTCTATCTGTATCAGCATTCTGTCTATGTTATCCAGCGCAACCGTGAAGCAACGTCCTG CCGATAATGATCGTTATGTGAAGAACTGTAGGAGTGGACGATCTCCCAAGGAGACAAGATGGTGGTTCCATGATGATAAGGTTTAA
AA sequence Show only first row Show all	>Potri.002G030800.1 pacid=42776753 polypeptide=Potri.002G030800.1.p locus=Potri.002G030800 ID=Potri.002G030800.1.v4.1 annot-version=v4.1 MTSSSASSRKALSKIACNRLQKELTEWQLSPPSSFKHKVTDNLQRWVIEANGAAGTLYANETYQLQVDFPEHYPMEAPQVIFAPPAPLHPHIYSNGHICL DILYDSWSPAMTVSSICISILSMLSSATVKQRPADNDRYVKNCRSGRSPKETRWWFHDDKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G42990		UBC18	ubiquitin-conjugating enzyme 1...		Potri.002G030800 [exp]	0	1
AT5G05800			unknown protein		Potri.004G135901 [exp]	4.24	0.6859
AT1G72820			Mitochondrial substrate carrie...		Potri.006G223600 [exp]	7.07	0.6577
AT5G25360			unknown protein		Potri.006G068600 [exp]	7.48	0.6846
AT1G33230			TMPIT-like protein (.1)		Potri.001G454400 [exp]	11.13	0.6659
AT5G47540			Mo25 family protein (.1)		Potri.016G011100 [exp]	15.87	0.6072
AT3G54380		AtSAC3C	yeast Sac3 homolog C, SAC3/GAN...		Potri.001G035700 [exp]	17.94	0.6299
AT1G06060			LisH and RanBPM domains contai...		Potri.002G029700 [exp]	21.74	0.5597
AT5G54540			Uncharacterised conserved prot...		Potri.011G130000 [exp]	35.24	0.6002
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Potri.009G044500 [exp]	38.41	0.6242	ATPH1.1
AT5G04270			DHHC-type zinc finger family p...		Potri.010G226100 [exp]	45.36	0.5535

Compare expression of checked genes

Potri.002G030800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.