Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04520 177 / 4e-58 Nucleic acid-binding, OB-fold-like protein (.1) AT5G35680 176 / 2e-57 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G160900 [exp] 178 / 2e-58 AT2G04520 200 / 3e-67 Nucleic acid-binding, OB-fold-like protein (.1) Potri.002G219200 [exp] 176 / 1e-57 AT2G04520 198 / 2e-66 Nucleic acid-binding, OB-fold-like protein (.1) Potri.014G093801 [exp] 64 / 2e-14 AT2G04520 76 / 2e-19 Nucleic acid-binding, OB-fold-like protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033806 [exp] 173 / 3e-56 AT2G04520 254 / 1e-88 Nucleic acid-binding, OB-fold-like protein (.1) Lus10014627 [exp] 173 / 3e-56 AT2G04520 254 / 1e-88 Nucleic acid-binding, OB-fold-like protein (.1) Lus10000920 [exp] 171 / 2e-55 AT2G04520 252 / 1e-87 Nucleic acid-binding, OB-fold-like protein (.1) Lus10002264 [exp] 166 / 2e-53 AT2G04520 248 / 6e-86 Nucleic acid-binding, OB-fold-like protein (.1) Lus10020713 [exp] 123 / 7e-37 AT2G04520 169 / 4e-55 Nucleic acid-binding, OB-fold-like protein (.1) Lus10029827 [exp] 122 / 2e-36 AT2G04520 168 / 9e-55 Nucleic acid-binding, OB-fold-like protein (.1) Lus10042438 [exp] 82 / 2e-20 AT2G04520 100 / 5e-28 Nucleic acid-binding, OB-fold-like protein (.1) Lus10034249 [exp] 40 / 0.0002 AT2G40780 197 / 4e-65 Nucleic acid-binding, OB-fold-like protein (.1.2) Lus10029014 [exp] 39 / 0.0008 AT2G40780 199 / 4e-66 Nucleic acid-binding, OB-fold-like protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [poplar] [flax] OB PF01176 [poplar] [flax] eIF-1a Translation initiation factor 1A / IF-1
Representative CDS sequence Show only first row Show all	>Potri.002G031700.1 pacid=42777458 polypeptide=Potri.002G031700.1.p locus=Potri.002G031700 ID=Potri.002G031700.1.v4.1 annot-version=v4.1 ATGCCGAAGAACAAGGGAAAGGGAGGAAAGAATAGGAAGAGAGGAAAGAACGAAGCTGTTGTCGGGAAGCGGGAGCTTATTTTTAAGGAAGAAGGACAGG AGTATGCCCAAGTGCTTCGCATGCTCGGAAATGGTCGTTGCGACGCTATGTGTTTTGATGGGACCAAGCGTCTTTGCCATATTCGAGGGAAGATGCACAG GAAGGTCTGGATTGATGCTGGTGATATAATTCTCGTTGGTCTCCGCGACTACCAGGATCACAAGGCTGACATTATATTGAAGTACCGGACCTATGAAGCT AGGCTTCTGAAGGCCTATGGTGAGCTCCCTGCGAATACACGTATCAATGTAGGTATTGCTGGAGGTTTTGATGAGGAAGACGATGGTGATGATGATTATT TTGAGTTTATGAATGCCGGAACAAGCAGTGCGCATATAAACTTTATTTGA
AA sequence Show only first row Show all	>Potri.002G031700.1 pacid=42777458 polypeptide=Potri.002G031700.1.p locus=Potri.002G031700 ID=Potri.002G031700.1.v4.1 annot-version=v4.1 MPKNKGKGGKNRKRGKNEAVVGKRELIFKEEGQEYAQVLRMLGNGRCDAMCFDGTKRLCHIRGKMHRKVWIDAGDIILVGLRDYQDHKADIILKYRTYEA RLLKAYGELPANTRINVGIAGGFDEEDDGDDDYFEFMNAGTSSAHINFI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G04520			Nucleic acid-binding, OB-fold-...		Potri.002G031700 [exp]	0	1
AT3G61920			unknown protein		Potri.014G104900 [exp]	5.47	0.8519
AT1G23750			Nucleic acid-binding, OB-fold-...		Potri.001G396100 [exp]	10.34	0.8861
AT4G20990		ATACA4, ACA4	A. THALIANA ALPHA CARBONIC ANH...		Potri.006G047400 [exp]	13.49	0.8713
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Potri.010G105200 [exp]	17.83	0.8599
AT1G25520			Uncharacterized protein family...		Potri.019G116100 [exp]	21.54	0.8497
AT3G28455		CLE25	CLAVATA3/ESR-RELATED 25 (.1)		Potri.014G021250 [exp]	21.63	0.8585
AT3G52420		ATOEP7	outer envelope membrane protei...		Potri.005G208100 [exp]	22.97	0.7320	OM14.1
					Potri.007G034101 [exp]	26.36	0.8537
AT1G23220			Dynein light chain type 1 fami...		Potri.008G133000 [exp]	32.61	0.7959
AT3G48660			Protein of unknown function (D...		Potri.001G058001 [exp]	33.46	0.8511

Compare expression of checked genes

Potri.002G031700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.