Potri.002G031800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04940 363 / 1e-127 AtTic20-I, atTIC20, TIC20 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
AT1G04945 324 / 3e-107 HIT-type Zinc finger family protein (.1.2.3)
AT4G03320 175 / 1e-53 AtTic20-IV, TIC20-IV translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
AT2G47840 45 / 1e-05 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G231400 474 / 2e-171 AT1G04940 360 / 2e-126 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.019G108800 194 / 1e-60 AT4G03320 283 / 2e-95 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010636 351 / 5e-123 AT1G04940 338 / 9e-118 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10033195 349 / 4e-122 AT1G04940 341 / 7e-119 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10039783 171 / 8e-52 AT4G03320 263 / 1e-87 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Lus10026842 41 / 0.0004 AT2G47840 219 / 1e-72 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF16166 TIC20 Chloroplast import apparatus Tic20-like
Representative CDS sequence
>Potri.002G031800.1 pacid=42779722 polypeptide=Potri.002G031800.1.p locus=Potri.002G031800 ID=Potri.002G031800.1.v4.1 annot-version=v4.1
ATGATTCTAAATGGGTGTGCCATGCCTTCCGGGTCTGCTTTTAGTAGCACCAGAACATGTAAAACAATGCCTGGTATCATGGTTTCTGACCATGTTCCTT
ATACAACTGCAAGGGCTGCGTTGTTGAGCAGCAGGGCTTCATTGGAACGACATTTGGAGTCTAAATCCTGGTCATCTAGAGGTTTCCTTTCCTTGCACCT
GTCGGCTGCATCAACACCACTCTTAAGTGGAGATTATTGTGGATTTTCACACTATATTCCCACATTTCCTCGGCAGCGTAGATCCTATTCATGTCCTCGA
GCATCAAAAGATGTCCCATACAGTTTTCGCTTTCCTCCAATGACCAAGAAGCCAAGATGGTGGTGGAGGACTTTAGCATGCCTGCCCTATTTGATGCCTC
TTCATGAAACATGGATGTATGCTGAGACGGCATATCATCTACATCCCTTCCTTGAAGACTTTGAATTCTTGACCTACCCATTCCTTGGGGCAATTGGGAG
GTTACCAAGCTGGTTCTTGATGGCATATTTCTTTGTTGCATATCTTGGAGTAGTAAGAAGAAAGGAGTGGCCTCACTTTTTCAGATTTCATGTGGTAATG
GGCATGCTATTGGAGATTGCTCTCCAGGTGATAGGTACTGTGAGCCGATGGATGCCTCTTGCTGTTTATTGGGGTAAATTGGGCATGCACTTCTGGACAG
CTGTGGCATTTGCTTATCTTTTTACAGTCCTAGAGTGCATACGGTGTGCTCTTGCTGGCATGTACGCTGATGTCCCTTTTGCTTGTGATGCGGCATACAT
TCAAATCCCATACGATTAA
AA sequence
>Potri.002G031800.1 pacid=42779722 polypeptide=Potri.002G031800.1.p locus=Potri.002G031800 ID=Potri.002G031800.1.v4.1 annot-version=v4.1
MILNGCAMPSGSAFSSTRTCKTMPGIMVSDHVPYTTARAALLSSRASLERHLESKSWSSRGFLSLHLSAASTPLLSGDYCGFSHYIPTFPRQRRSYSCPR
ASKDVPYSFRFPPMTKKPRWWWRTLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYPFLGAIGRLPSWFLMAYFFVAYLGVVRRKEWPHFFRFHVVM
GMLLEIALQVIGTVSRWMPLAVYWGKLGMHFWTAVAFAYLFTVLECIRCALAGMYADVPFACDAAYIQIPYD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Potri.002G031800 0 1
AT1G42960 unknown protein Potri.005G254200 2.44 0.9306
AT2G41250 Haloacid dehalogenase-like hyd... Potri.006G040800 4.00 0.9203
AT3G23760 unknown protein Potri.001G068800 5.00 0.9046
AT1G32990 PRPL11 plastid ribosomal protein l11 ... Potri.011G150700 5.47 0.8938
AT5G16710 DHAR3 dehydroascorbate reductase 1 (... Potri.017G125100 10.09 0.9128
AT1G12910 LWD1, ATAN11 LIGHT-REGULATED WD 1, ANTHOCYA... Potri.002G220500 10.67 0.8576
AT4G24660 ZF_HD ATHB22, MEE68, ... ZINC FINGER HOMEODOMAIN 2, MAT... Potri.012G040900 12.64 0.9009
AT2G25320 TRAF-like family protein (.1) Potri.006G065300 13.30 0.8568
AT3G07910 unknown protein Potri.009G071900 16.76 0.7930
AT3G48730 GSA2 glutamate-1-semialdehyde 2,1-a... Potri.015G101100 18.97 0.9055 Pt-GSA1.1

Potri.002G031800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.