Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75330 75 / 8e-18 OTC ornithine carbamoyltransferase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G229400 [exp] 81 / 8e-20 AT1G75330 561 / 0.0 ornithine carbamoyltransferase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010641 [exp] 79 / 6e-19 AT1G75330 547 / 0.0 ornithine carbamoyltransferase (.1) Lus10033203 [exp] 78 / 7e-19 AT1G75330 546 / 0.0 ornithine carbamoyltransferase (.1) Lus10000002 [exp] 62 / 1e-14 AT1G75330 85 / 2e-21 ornithine carbamoyltransferase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02729 [poplar] [flax] OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Representative CDS sequence Show only first row Show all	>Potri.002G033701.3 pacid=42779697 polypeptide=Potri.002G033701.3.p locus=Potri.002G033701 ID=Potri.002G033701.3.v4.1 annot-version=v4.1 ATGGCATGTGTTTTTGCTCATAAGGACATCCCTGACCTGGCAAAATATGCAATAGTACCTGTTATTAATAGCCTGACTGATGACGACCATCTTTGCCAAA TGATGGCTGATGCTCTCATGAAAATTGAACATGGTGGCCGGTTGGAAGGAACCATGGTTGTTTATGTTGGGGTCGGGAATAACGTTGTATACTCTTGGTT GCTGTGA
AA sequence Show only first row Show all	>Potri.002G033701.3 pacid=42779697 polypeptide=Potri.002G033701.3.p locus=Potri.002G033701 ID=Potri.002G033701.3.v4.1 annot-version=v4.1 MACVFAHKDIPDLAKYAIVPVINSLTDDDHLCQMMADALMKIEHGGRLEGTMVVYVGVGNNVVYSWLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75330		OTC	ornithine carbamoyltransferase...		Potri.002G033701 [exp]	0	1
AT1G17840		AtABCG11, WBC11...	DESPERADO, CUTICULAR DEFECT AN...		Potri.005G073100 [exp]	23.81	0.8306
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Potri.001G372400 [exp]	27.05	0.7707
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.006G036000 [exp]	28.56	0.8340
AT1G11330			S-locus lectin protein kinase ...		Potri.001G412100 [exp]	29.29	0.8319
AT3G01400			ARM repeat superfamily protein...		Potri.014G016400 [exp]	37.41	0.7965
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Potri.008G095500 [exp]	48.08	0.8282
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Potri.017G078100 [exp]	61.71	0.8190
AT4G10770		ATOPT7	ARABIDOPSIS THALIANA OLIGOPEPT...		Potri.007G056900 [exp]	78.26	0.7902
AT4G32940		GAMMAVPE, GAMMA...	gamma vacuolar processing enzy...		Potri.006G232900 [exp]	183.30	0.7619	Pt-GAMMA-VPE.2
AT1G12990			beta-1,4-N-acetylglucosaminylt...		Potri.008G186000 [exp]	265.32	0.7454

Compare expression of checked genes

Potri.002G033701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.