Potri.002G034500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G19530 62 / 5e-13 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G228600 176 / 8e-58 AT1G19530 81 / 2e-20 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002540 55 / 1e-10 AT1G19530 44 / 2e-06 unknown protein
PFAM info
Representative CDS sequence
>Potri.002G034500.1 pacid=42779143 polypeptide=Potri.002G034500.1.p locus=Potri.002G034500 ID=Potri.002G034500.1.v4.1 annot-version=v4.1
ATGGGATCTTTAATGTCTGGTTGGGACTCACCTGTCCCTGATCGTGAATCAGTGAAATACCAAAGGAATAGGTCACAAACTAAAGGAGACATTGATGCTT
ACTGGAAATCGAAGAAGAAAACAGAGGAGGATCATCTCAAAGTTTTCTCTAGTCCATCAAATAGCAACCAGGATGGCATGTACGAAGATGATGGAGTAAA
GTTTCAGAGACCAAGCTCTCCAGCCGATACAGAGGAGTTCATGGACACGGAAGATGAACCAAGTCTGGAGCAAGTCATCAAGAAAAATGGCTGGTGGGCA
AGTAGCATCTGGGCATTTCTAAATGAAACACCAGAACTGGAACGTTCCTCCAACAATTACTCACCACAGTTTCACATCGCCAGCTCAAAATCCATCAGTG
GAGCCAGTGCTGTGTGA
AA sequence
>Potri.002G034500.1 pacid=42779143 polypeptide=Potri.002G034500.1.p locus=Potri.002G034500 ID=Potri.002G034500.1.v4.1 annot-version=v4.1
MGSLMSGWDSPVPDRESVKYQRNRSQTKGDIDAYWKSKKKTEEDHLKVFSSPSNSNQDGMYEDDGVKFQRPSSPADTEEFMDTEDEPSLEQVIKKNGWWA
SSIWAFLNETPELERSSNNYSPQFHIASSKSISGASAV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G19530 unknown protein Potri.002G034500 0 1
AT5G22360 ATVAMP714 vesicle-associated membrane pr... Potri.001G219200 2.00 0.9000
AT3G26040 HXXXD-type acyl-transferase fa... Potri.008G180400 2.44 0.9014
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Potri.003G218900 3.00 0.8744
Potri.013G028450 3.16 0.8979
AT2G36290 alpha/beta-Hydrolases superfam... Potri.010G237800 4.00 0.8826
AT4G30420 nodulin MtN21 /EamA-like trans... Potri.006G177600 4.00 0.9027
AT4G37630 CYCD5;1 cyclin d5;1 (.1.2) Potri.002G119000 5.00 0.8443
AT1G13340 Regulator of Vps4 activity in ... Potri.010G127000 9.53 0.8660
Potri.010G169350 10.09 0.8165
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Potri.016G046200 10.24 0.8652 FAD2.3

Potri.002G034500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.