Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47271 102 / 3e-28 Cystathionine beta-synthase (CBS) family protein (.1) AT5G10860 92 / 5e-24 CBSX3 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G228300 [exp] 172 / 1e-55 AT1G47271 251 / 1e-85 Cystathionine beta-synthase (CBS) family protein (.1) Potri.017G000100 [exp] 97 / 3e-26 AT5G10860 339 / 2e-120 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Potri.013G161500 [exp] 90 / 2e-23 AT5G10860 343 / 8e-122 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001964 [exp] 102 / 5e-28 AT1G47271 202 / 5e-66 Cystathionine beta-synthase (CBS) family protein (.1) Lus10019117 [exp] 100 / 4e-27 AT5G10860 347 / 2e-123 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Lus10034441 [exp] 96 / 4e-24 AT5G10860 350 / 4e-120 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Lus10035014 [exp] 86 / 2e-21 AT5G10860 341 / 5e-121 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Lus10021675 [exp] 83 / 2e-20 AT5G10860 338 / 7e-120 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00571 [poplar] [flax] CBS CBS domain
Representative CDS sequence Show only first row Show all	>Potri.002G034800.7 pacid=42779966 polypeptide=Potri.002G034800.7.p locus=Potri.002G034800 ID=Potri.002G034800.7.v4.1 annot-version=v4.1 ATGCAAGGACTTGTCCAGGGGGTAAGATCTTGCCAGGAAACCCTCAGAGTGGCAATTCTAAGGCATCCTCATGTCAGAGACATAATTGAGAGGAGAAAGA TATTATCACATTCTGGATGTGTGACCTCCTCTCCTCCAGTGGGAGAGAAAGGACTAGAGAATTTAACAGTGGCAGATGTACTGGTGACAAAGGGAGAAGA AAAGCTTGGCTCTTGGCTCTGGTGCCGCACCACTGACACCGTTTATGATGCTGTGAAGAATATGGCGCAGAATAATATTGGGTCACTGGTAGTCTTAGGA GAACGAGAGCTTATCGCAGGAATTATCACAGAGAGAGCAGACTTATCTGAGGAAGATAATAGCACAAGGGAGATCATCTAA
AA sequence Show only first row Show all	>Potri.002G034800.7 pacid=42779966 polypeptide=Potri.002G034800.7.p locus=Potri.002G034800 ID=Potri.002G034800.7.v4.1 annot-version=v4.1 MQGLVQGVRSCQETLRVAILRHPHVRDIIERRKILSHSGCVTSSPPVGEKGLENLTVADVLVTKGEEKLGSWLWCRTTDTVYDAVKNMAQNNIGSLVVLG ERELIAGIITERADLSEEDNSTREII

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47271			Cystathionine beta-synthase (C...		Potri.002G034800 [exp]	0	1
AT3G15800			Glycosyl hydrolase superfamily...		Potri.001G192200 [exp]	4.58	0.9517
AT5G03795			Exostosin family protein (.1)		Potri.014G171100 [exp]	6.24	0.9189
					Potri.008G018000 [exp]	7.48	0.9396
AT1G76040		CPK29	calcium-dependent protein kina...		Potri.002G017000 [exp]	10.24	0.9370
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.001G340500 [exp]	10.81	0.9388
AT1G75260			oxidoreductases, acting on NAD...		Potri.002G034700 [exp]	12.00	0.9219
AT3G17380			TRAF-like family protein (.1)		Potri.001G130700 [exp]	12.48	0.9387
AT2G41200			unknown protein		Potri.006G038600 [exp]	16.12	0.9212
AT4G33490			Eukaryotic aspartyl protease f...		Potri.007G099200 [exp]	16.97	0.9243
AT5G04890		RTM2	RESTRICTED TEV MOVEMENT 2, HSP...		Potri.010G245500 [exp]	17.54	0.9185

Compare expression of checked genes

Potri.002G034800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.