Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24530 159 / 4e-47 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 151 / 9e-44 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 149 / 5e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 125 / 1e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G07480 122 / 8e-33 KUOX1 KAR-UP oxidoreductase 1 (.1) AT3G60290 120 / 6e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 120 / 8e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 114 / 9e-30 ATSRG1, SRG1 senescence-related gene 1 (.1) AT2G44800 114 / 2e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 112 / 4e-29 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G039500 [exp] 217 / 2e-69 AT4G10500 244 / 1e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G013600 [exp] 199 / 3e-62 AT4G10500 235 / 4e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G223000 [exp] 199 / 3e-62 AT4G10500 238 / 3e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G039600 [exp] 172 / 2e-52 AT4G10500 194 / 8e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 169 / 7e-51 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451700 [exp] 169 / 8e-51 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 166 / 2e-49 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 166 / 2e-49 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 164 / 4e-49 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035782 [exp] 235 / 2e-76 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000711 [exp] 184 / 1e-56 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 181 / 2e-55 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 167 / 8e-50 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 165 / 4e-49 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 162 / 5e-48 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 124 / 4e-33 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 122 / 1e-32 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022292 [exp] 120 / 8e-32 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10032502 [exp] 120 / 1e-31 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.002G040400.1 pacid=42779817 polypeptide=Potri.002G040425.1.p locus=Potri.002G040400 ID=Potri.002G040400.1.v4.1 annot-version=v4.1 ATGAAAATACGGTTGATTAATCATGGGATCTCGGAGAAGATAATGCATGATGTCTCAGAGGTGGTGAATGAGTTCTTTCAACTGCCTGCCAACGAAAAAG AAAGGTTCTGCTCTAATGACCCGAAACAAAGTTGCAGACTATCCACAAGCATCGACTATTTTCAGGAAAAGATACAATACTGGAGAGACAACTTGCGACA CCAATGCCATCCTCTTGAGGAACACTTTCAAGAAGTGGCTGGGACGTATTCGGTCGAGGTTAGGAAACTGAGCTTGTTGCTATTGGATCTAATCTGCGAA GGGTTAGGACTTGAAAGTAGATATTTTAATGGGAATGGCCTAAGCCAAGTCCAATTGATGAGCATTAATCACTATCCACCATCCTCAGATCCGAGTTTAA CCTTGGGATTGCCTAAACATACTGGAGAAGTGCCAGGGCTTCAAGTCCTCGAGGACGGAAAATGGCTTGCTGTTGATCCTCTTCCTACTGCATTTGTCAT CACCATTGGCTATGTGTTTCAGGTTATAAGTAATGGGAAGCTGAAGAGTGTCGATCAAAGGGTGGTCACGAATTCAAAGGTTGCACGAACAACGGTTGGC ATCTGCATCTTTCCTTCTTCTGATAGCCGTATCGAACCCGCAAAAGATCTGGTTGACAAGTGCCATCCTCCACTCTATAAAAGTTTCATATGCAAAGATT TTAGTGACACATATATCTCTGAGATCATCAATGGAATAACAACTGAGCGTTATAAACTCCATCTTTCTGAATAA
AA sequence Show only first row Show all	>Potri.002G040400.1 pacid=42779817 polypeptide=Potri.002G040425.1.p locus=Potri.002G040400 ID=Potri.002G040400.1.v4.1 annot-version=v4.1 MKIRLINHGISEKIMHDVSEVVNEFFQLPANEKERFCSNDPKQSCRLSTSIDYFQEKIQYWRDNLRHQCHPLEEHFQEVAGTYSVEVRKLSLLLLDLICE GLGLESRYFNGNGLSQVQLMSINHYPPSSDPSLTLGLPKHTGEVPGLQVLEDGKWLAVDPLPTAFVITIGYVFQVISNGKLKSVDQRVVTNSKVARTTVG ICIFPSSDSRIEPAKDLVDKCHPPLYKSFICKDFSDTYISEIINGITTERYKLHLSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24530		DMR6	DOWNY MILDEW RESISTANT 6, 2-ox...		Potri.002G040400 [exp]	0	1
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Potri.001G205200 [exp]	18.76	0.6926	Pt-PIN2.1,PIN10
					Potri.001G306932 [exp]	21.56	0.6592
AT3G57810			Cysteine proteinases superfami...		Potri.010G057750 [exp]	30.16	0.6378
AT2G16530			3-oxo-5-alpha-steroid 4-dehydr...		Potri.009G125200 [exp]	42.40	0.5603
AT5G09360		LAC14	laccase 14 (.1)		Potri.001G206200 [exp]	46.13	0.6366
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Potri.005G053100 [exp]	55.96	0.5409
AT2G15220			Plant basic secretory protein ...		Potri.001G299500 [exp]	58.01	0.6016
AT5G17600			RING/U-box superfamily protein...		Potri.010G206200 [exp]	59.27	0.6208
AT5G64700			nodulin MtN21 /EamA-like trans...		Potri.011G148600 [exp]	81.03	0.5706
AT3G30387			Protein of unknown function (D...		Potri.017G029250 [exp]	81.97	0.6000

Compare expression of checked genes

Potri.002G040400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.